Protein Information |
|
|---|---|
| Protein Name | Cyclin-dependent kinase 7 |
| Accession Code | P50613 |
| Gene | CDK7 |
| Organism | Homo sapiens | Human (Taxonomy: 9606) |
| Part of Reference Proteome? | Yes |
| Sequence (Length: 346) | |
|
MALDVKSRAKRYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSEAKDGINRTALREIKLLQELSHPNIIGLLDA FGHKSNISLVFDFMETDLEVIIKDNSLVLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAK SFGSPNRAYTHQVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDM CSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCARITATQALKMKYFSNRPGPTPGCQLPRPNCPVETLKEQ SNPALAIKRKRTEALEQGGLPKKLIF |
|
Structure Viewer (PDB: 6XBZ) |
|---|
Description |
|
|---|---|
| Serine/threonine kinase involved in cell cycle control and in RNA polymerase II-mediated RNA transcription. Cyclin-dependent kinases (CDKs) are activated by the binding to a cyclin and mediate the progression through the cell cycle. Each different complex controls a specific transition between 2 subsequent phases in the cell cycle. Required for both activation and complex formation of CDK1/cyclin-B during G2-M transition, and for activation of CDK2/cyclins during G1-S transition (but not complex formation). CDK7 is the catalytic subunit of the CDK-activating kinase (CAK) complex. Phosphorylates SPT5/SUPT5H, SF1/NR5A1, POLR2A, p53/TP53, CDK1, CDK2, CDK4, CDK6 and CDK11B/CDK11. CAK activates the cyclin-associated kinases CDK1, CDK2, CDK4 and CDK6 by threonine phosphorylation, thus regulating cell cycle progression. CAK complexed to the core-TFIIH basal transcription factor activates RNA polymerase II by serine phosphorylation of the repetitive C- terminal domain (CTD) of its large subunit (POLR2A), allowing its escape from the promoter and elongation of the transcripts (PubMed:9852112). Phosphorylation of POLR2A in complex with DNA promotes transcription initiation by triggering dissociation from DNA. Its expression and activity are constant throughout the cell cycle. Upon DNA damage, triggers p53/TP53 activation by phosphorylation, but is inactivated in turn by p53/TP53; this feedback loop may lead to an arrest of the cell cycle and of the transcription, helping in cell recovery, or to apoptosis. Required for DNA-bound peptides-mediated transcription and cellular growth inhibition. {Experimental EvidencePubMed:10024882, Experimental EvidencePubMed:11113184, Experimental EvidencePubMed:16327805, Experimental EvidencePubMed:17373709, Experimental EvidencePubMed:17386261, Experimental EvidencePubMed:17901130, Experimental EvidencePubMed:19015234, Experimental EvidencePubMed:19071173, Experimental EvidencePubMed:19136461, Experimental EvidencePubMed:19450536, Experimental EvidencePubMed:19667075, Experimental EvidencePubMed:20360007, Experimental EvidencePubMed:9372954, Experimental EvidencePubMed:9840937, Experimental EvidencePubMed:9852112}. | Assigned Ontology terms |
| Biological Process | Cell Cycle (GO:0007049) Cell Division (GO:0051301) DNA Repair (GO:0006281) Phosphorylation Of RNA Polymerase II C-Terminal Domain (GO:0070816) Positive Regulation Of Transcription By RNA Polymerase II (GO:0045944) Protein Phosphorylation (GO:0006468) Protein Stabilization (GO:0050821) Regulation Of Cell Cycle (GO:0051726) Regulation Of Cyclin-Dependent Protein Serine/Threonine Kinase Activity (GO:0000079) Regulation Of G1/S Transition Of Mitotic Cell Cycle (GO:2000045) SnRNA Transcription By RNA Polymerase II (GO:0042795) Transcription By RNA Polymerase II (GO:0006366) Transcription Initiation At RNA Polymerase II Promoter (GO:0006367) |
| Molecular Function | ATP Binding (GO:0005524) ATP-Dependent Activity, Acting On DNA (GO:0008094) Cyclin-Dependent Protein Serine/Threonine Kinase Activity (GO:0004693) Protein C-Terminus Binding (GO:0008022) Protein Kinase Activity (GO:0004672) Protein Serine Kinase Activity (GO:0106310) Protein Serine/Threonine Kinase Activity (GO:0004674) RNA Polymerase II CTD Heptapeptide Repeat Kinase Activity (GO:0008353) |
Interactions with Nuclear Envelope proteins (7 interactors) |
|||
|---|---|---|---|
| Partner (NucEnvDB) | IntAct | Confidence score | |
| O15027 | Protein transport protein Sec16A | EBI-16790014 | 0.35 |
| P12270 | Nucleoprotein TPR | EBI-16790014 | 0.35 |
| Q9UBF8 | Phosphatidylinositol 4-kinase beta | EBI-21835901 | 0.35 |
| Q92621 | Nuclear pore complex protein Nup205 | EBI-16789709 | 0.27 |
| Q13137 | Calcium-binding and coiled-coil domain-containing protein 2 | EBI-21835901 | 0.35 |
| Q9BWU1 | Cyclin-dependent kinase 19 | EBI-15560892 | 0.44 |
| P11802 | Cyclin-dependent kinase 4 | EBI-15560841 | 0.44 | Interactions with other proteins (127 interactors) |
| Partner (UniProt) | IntAct | Confidence score | |
| P51948 | CDK-activating kinase assembly factor MAT1 (CDK7/cyclin-H assembly factor) (Cyclin-G1-interacting protein) (Menage a trois) (RING finger protein 66) (RING finger protein MAT1) (p35) (p36) | EBI-1245984 | 0.82 |
| P51946 | Cyclin-H (MO15-associated protein) (p34) (p37) | EBI-1245984 | 0.93 |
| P32121 | Beta-arrestin-2 (Arrestin beta-2) (Non-visual arrestin-3) | EBI-1642567 | 0.35 |
| A0A380PKN3 | Putative N-acetylglucosamine-6-phosphate deacetylase (EC 3.5.1.25) | EBI-2873645 | 0.00 |
| P31016 | Disks large homolog 4 (Postsynaptic density protein 95) (PSD-95) (Synapse-associated protein 90) (SAP-90) (SAP90) | EBI-7960638 | 0.44 |
| P51659 | Peroxisomal multifunctional enzyme type 2 (MFE-2) (17-beta-hydroxysteroid dehydrogenase 4) (17-beta-HSD 4) (D-bifunctional protein) (DBP) (Multifunctional protein 2) (MFP-2) (Short chain dehydrogenase/reductase family 8C member 1) [Cleaved into: (3R)-hydroxyacyl-CoA dehydrogenase (EC 1.1.1.n12); Enoyl-CoA hydratase 2 (EC 4.2.1.107) (EC 4.2.1.119) (3-alpha,7-alpha,12-alpha-trihydroxy-5-beta-cholest-24-enoyl-CoA hydratase)] | EBI-3906748 | 0.37 |
| P01909 | HLA class II histocompatibility antigen, DQ alpha 1 chain (DC-1 alpha chain) (DC-alpha) (HLA-DCA) (MHC class II DQA1) | EBI-3906738 | 0.37 |
| P24941 | Cyclin-dependent kinase 2 (EC 2.7.11.22) (Cell division protein kinase 2) (p33 protein kinase) | EBI-6255891 | 0.71 |
| P01023 | Alpha-2-macroglobulin (Alpha-2-M) (C3 and PZP-like alpha-2-macroglobulin domain-containing protein 5) | EBI-6380434 | 0.35 |
| P32780 | General transcription factor IIH subunit 1 (Basic transcription factor 2 62 kDa subunit) (BTF2 p62) (General transcription factor IIH polypeptide 1) (TFIIH basal transcription factor complex p62 subunit) | EBI-6380434 | 0.76 |
| P48740 | Mannan-binding lectin serine protease 1 (EC 3.4.21.-) (Complement factor MASP-3) (Complement-activating component of Ra-reactive factor) (Mannose-binding lectin-associated serine protease 1) (MASP-1) (Mannose-binding protein-associated serine protease) (Ra-reactive factor serine protease p100) (RaRF) (Serine protease 5) [Cleaved into: Mannan-binding lectin serine protease 1 heavy chain; Mannan-binding lectin serine protease 1 light chain] | EBI-6380434 | 0.35 |
| P19447 | General transcription and DNA repair factor IIH helicase subunit XPB (TFIIH subunit XPB) (EC 3.6.4.12) (Basic transcription factor 2 89 kDa subunit) (BTF2 p89) (DNA excision repair protein ERCC-3) (DNA repair protein complementing XP-B cells) (TFIIH basal transcription factor complex 89 kDa subunit) (TFIIH 89 kDa subunit) (TFIIH p89) (Xeroderma pigmentosum group B-complementing protein) | EBI-6380434 | 0.74 |
| P18074 | General transcription and DNA repair factor IIH helicase subunit XPD (TFIIH subunit XPD) (EC 3.6.4.12) (Basic transcription factor 2 80 kDa subunit) (BTF2 p80) (CXPD) (DNA excision repair protein ERCC-2) (DNA repair protein complementing XP-D cells) (TFIIH basal transcription factor complex 80 kDa subunit) (TFIIH 80 kDa subunit) (TFIIH p80) (Xeroderma pigmentosum group D-complementing protein) | EBI-6380434 | 0.74 |
| Q92759 | General transcription factor IIH subunit 4 (Basic transcription factor 2 52 kDa subunit) (BTF2 p52) (General transcription factor IIH polypeptide 4) (TFIIH basal transcription factor complex p52 subunit) | EBI-6380434 | 0.67 |
| Q13888 | General transcription factor IIH subunit 2 (Basic transcription factor 2 44 kDa subunit) (BTF2 p44) (General transcription factor IIH polypeptide 2) (TFIIH basal transcription factor complex p44 subunit) | EBI-6380434 | 0.67 |
| P23634 | Plasma membrane calcium-transporting ATPase 4 (PMCA4) (EC 7.2.2.10) (Matrix-remodeling-associated protein 1) (Plasma membrane calcium ATPase isoform 4) (Plasma membrane calcium pump isoform 4) | EBI-6380434 | 0.35 |
| P28715 | DNA excision repair protein ERCC-5 (EC 3.1.-.-) (DNA repair protein complementing XP-G cells) (Xeroderma pigmentosum group G-complementing protein) | EBI-6380434 | 0.67 |
| Q13889 | General transcription factor IIH subunit 3 (Basic transcription factor 2 34 kDa subunit) (BTF2 p34) (General transcription factor IIH polypeptide 3) (TFIIH basal transcription factor complex p34 subunit) | EBI-6380434 | 0.67 |
| Q6ZYL4 | General transcription factor IIH subunit 5 (General transcription factor IIH polypeptide 5) (TFB5 ortholog) (TFIIH basal transcription factor complex TTD-A subunit) (TFIIH subunit p8) | EBI-6380434 | 0.74 |
| P78362 | SRSF protein kinase 2 (EC 2.7.11.1) (SFRS protein kinase 2) (Serine/arginine-rich protein-specific kinase 2) (SR-protein-specific kinase 2) [Cleaved into: SRSF protein kinase 2 N-terminal; SRSF protein kinase 2 C-terminal] | EBI-6657590 | 0.59 |
| Q96SB4 | SRSF protein kinase 1 (EC 2.7.11.1) (SFRS protein kinase 1) (Serine/arginine-rich protein-specific kinase 1) (SR-protein-specific kinase 1) | EBI-6659767 | 0.59 |
| P08238 | Heat shock protein HSP 90-beta (HSP 90) (Heat shock 84 kDa) (HSP 84) (HSP84) | EBI-6424069 | 0.56 |
| Q01094 | Transcription factor E2F1 (E2F-1) (PBR3) (Retinoblastoma-associated protein 1) (RBAP-1) (Retinoblastoma-binding protein 3) (RBBP-3) (pRB-binding protein E2F-1) | EBI-6599707 | 0.27 |
| Q6P1K8 | General transcription factor IIH subunit 2-like protein (General transcription factor IIH polypeptide 2-like protein) | EBI-21622006 | 0.53 |
| O96006 | E3 SUMO-protein ligase ZBED1 (EC 2.3.2.-) (DNA replication-related element-binding factor) (Putative Ac-like transposable element) (Zinc finger BED domain-containing protein 1) (dREF homolog) | EBI-21692488 | 0.35 |
| P14635 | G2/mitotic-specific cyclin-B1 | EBI-21835901 | 0.35 |
| Q58FG0 | Putative heat shock protein HSP 90-alpha A5 (Heat shock protein 90-alpha E) (Heat shock protein 90Ae) | EBI-21835901 | 0.35 |
| Q96NH3 | Protein broad-minded (TBC1 domain family member 32) | EBI-21835901 | 0.35 |
| Q8IZL9 | Cyclin-dependent kinase 20 (EC 2.7.11.22) (CDK-activating kinase p42) (CAK-kinase p42) (Cell cycle-related kinase) (Cell division protein kinase 20) (Cyclin-dependent protein kinase H) (Cyclin-kinase-activating kinase p42) | EBI-21835901 | 0.35 |
| Q58FG1 | Putative heat shock protein HSP 90-alpha A4 (Heat shock 90 kDa protein 1 alpha-like 2) (Heat shock protein 90-alpha D) (Heat shock protein 90Ad) | EBI-21835901 | 0.35 |
| Q58FF7 | Putative heat shock protein HSP 90-beta-3 (Heat shock protein 90-beta c) (Heat shock protein 90Bc) | EBI-21835901 | 0.35 |
| Q58FF6 | Putative heat shock protein HSP 90-beta 4 | EBI-21835901 | 0.35 |
| Q13451 | Peptidyl-prolyl cis-trans isomerase FKBP5 (PPIase FKBP5) (EC 5.2.1.8) (51 kDa FK506-binding protein) (51 kDa FKBP) (FKBP-51) (54 kDa progesterone receptor-associated immunophilin) (Androgen-regulated protein 6) (FF1 antigen) (FK506-binding protein 5) (FKBP-5) (FKBP54) (p54) (HSP90-binding immunophilin) (Rotamase) | EBI-21835901 | 0.35 |
| P46527 | Cyclin-dependent kinase inhibitor 1B (Cyclin-dependent kinase inhibitor p27) (p27Kip1) | EBI-21835901 | 0.35 |
| P24864 | G1/S-specific cyclin-E1 | EBI-21835901 | 0.35 |
| P20248 | Cyclin-A2 (Cyclin-A) (Cyclin A) | EBI-21835901 | 0.35 |
| P07900 | Heat shock protein HSP 90-alpha (EC 3.6.4.10) (Heat shock 86 kDa) (HSP 86) (HSP86) (Lipopolysaccharide-associated protein 2) (LAP-2) (LPS-associated protein 2) (Renal carcinoma antigen NY-REN-38) | EBI-21835901 | 0.35 |
| P06493 | Cyclin-dependent kinase 1 (CDK1) (EC 2.7.11.22) (EC 2.7.11.23) (Cell division control protein 2 homolog) (Cell division protein kinase 1) (p34 protein kinase) | EBI-15560801 | 0.44 |
| P24928 | DNA-directed RNA polymerase II subunit RPB1 (RNA polymerase II subunit B1) (EC 2.7.7.6) (DNA-directed RNA polymerase II subunit A) (DNA-directed RNA polymerase III largest subunit) (RNA-directed RNA polymerase II subunit RPB1) (EC 2.7.7.48) | EBI-15560781 | 0.44 |
| Q6IAW3 | CDK5 protein | EBI-15560872 | 0.44 |
| O00267 | Transcription elongation factor SPT5 (hSPT5) (DRB sensitivity-inducing factor 160 kDa subunit) (DSIF p160) (DRB sensitivity-inducing factor large subunit) (DSIF large subunit) (Tat-cotransactivator 1 protein) (Tat-CT1 protein) | EBI-15560912 | 0.44 |
| P21127 | Cyclin-dependent kinase 11B (EC 2.7.11.22) (Cell division cycle 2-like protein kinase 1) (CLK-1) (Cell division protein kinase 11B) (Galactosyltransferase-associated protein kinase p58/GTA) (PITSLRE serine/threonine-protein kinase CDC2L1) (p58 CLK-1) | EBI-15560932 | 0.44 |
| Q9NXF1 | Testis-expressed protein 10 | EBI-16789709 | 0.27 |
| Q96PZ0 | Pseudouridylate synthase 7 homolog (EC 5.4.99.-) | EBI-16789709 | 0.27 |
| Q8WUA4 | General transcription factor 3C polypeptide 2 (TF3C-beta) (Transcription factor IIIC 110 kDa subunit) (TFIIIC 110 kDa subunit) (TFIIIC110) (Transcription factor IIIC subunit beta) | EBI-16789709 | 0.27 |
| Q7Z4V5 | Hepatoma-derived growth factor-related protein 2 (HDGF-related protein 2) (HRP-2) (Hepatoma-derived growth factor 2) (HDGF-2) | EBI-16789709 | 0.27 |
| O15355 | Protein phosphatase 1G (EC 3.1.3.16) (Protein phosphatase 1C) (Protein phosphatase 2C isoform gamma) (PP2C-gamma) (Protein phosphatase magnesium-dependent 1 gamma) | EBI-16789709 | 0.27 |
| Q13042 | Cell division cycle protein 16 homolog (Anaphase-promoting complex subunit 6) (APC6) (CDC16 homolog) (CDC16Hs) (Cyclosome subunit 6) | EBI-16789709 | 0.27 |
| Q8N1G0 | Zinc finger protein 687 | EBI-16789709 | 0.27 |
| P30260 | Cell division cycle protein 27 homolog (Anaphase-promoting complex subunit 3) (APC3) (CDC27 homolog) (CDC27Hs) (H-NUC) | EBI-16789709 | 0.27 |
| Q96ME7 | Zinc finger protein 512 | EBI-16789709 | 0.27 |
| Q8TDI0 | Chromodomain-helicase-DNA-binding protein 5 (CHD-5) (EC 3.6.4.12) (ATP-dependent helicase CHD5) | EBI-16789709 | 0.27 |
| Q7Z5K2 | Wings apart-like protein homolog (Friend of EBNA2 protein) (WAPL cohesin release factor) | EBI-16789709 | 0.27 |
| Q9NW82 | WD repeat-containing protein 70 | EBI-16789709 | 0.27 |
| Q9Y3C7 | Mediator of RNA polymerase II transcription subunit 31 (Mediator complex subunit 31) (Mediator complex subunit SOH1) (hSOH1) | EBI-16789709 | 0.27 |
| Q9Y2R4 | Probable ATP-dependent RNA helicase DDX52 (EC 3.6.4.13) (ATP-dependent RNA helicase ROK1-like) (DEAD box protein 52) | EBI-16789709 | 0.27 |
| Q9UK58 | Cyclin-L1 (Cyclin-L) | EBI-16789709 | 0.27 |
| Q9NY93 | Probable ATP-dependent RNA helicase DDX56 (EC 3.6.4.13) (ATP-dependent 61 kDa nucleolar RNA helicase) (DEAD box protein 21) (DEAD box protein 56) | EBI-16789709 | 0.27 |
| Q9NX58 | Cell growth-regulating nucleolar protein | EBI-16789709 | 0.27 |
| Q9NW13 | RNA-binding protein 28 (RNA-binding motif protein 28) | EBI-16789709 | 0.27 |
| Q9NVC6 | Mediator of RNA polymerase II transcription subunit 17 (Activator-recruited cofactor 77 kDa component) (ARC77) (Cofactor required for Sp1 transcriptional activation subunit 6) (CRSP complex subunit 6) (Mediator complex subunit 17) (Thyroid hormone receptor-associated protein complex 80 kDa component) (Trap80) (Transcriptional coactivator CRSP77) (Vitamin D3 receptor-interacting protein complex 80 kDa component) (DRIP80) | EBI-16789709 | 0.27 |
| Q9H0A0 | RNA cytidine acetyltransferase (EC 2.3.1.-) (18S rRNA cytosine acetyltransferase) (N-acetyltransferase 10) (N-acetyltransferase-like protein) (hALP) | EBI-16789709 | 0.27 |
| Q9BZE4 | GTP-binding protein 4 (Chronic renal failure gene protein) (GTP-binding protein NGB) (Nucleolar GTP-binding protein 1) | EBI-16789709 | 0.27 |
| Q96S94 | Cyclin-L2 (Paneth cell-enhanced expression protein) | EBI-16789709 | 0.27 |
| Q8TF01 | Arginine/serine-rich protein PNISR (PNN-interacting serine/arginine-rich protein) (SR-related protein) (SR-rich protein) (Serine/arginine-rich-splicing regulatory protein 130) (SRrp130) (Splicing factor, arginine/serine-rich 130) (Splicing factor, arginine/serine-rich 18) | EBI-16789709 | 0.27 |
| Q8IY81 | pre-rRNA 2'-O-ribose RNA methyltransferase FTSJ3 (EC 2.1.1.-) (Protein ftsJ homolog 3) (Putative rRNA methyltransferase 3) | EBI-16789709 | 0.27 |
| Q8IX01 | SURP and G-patch domain-containing protein 2 (Arginine/serine-rich-splicing factor 14) (Splicing factor, arginine/serine-rich 14) | EBI-16789709 | 0.27 |
| Q6PD62 | RNA polymerase-associated protein CTR9 homolog (SH2 domain-binding protein 1) | EBI-16789709 | 0.27 |
| Q16543 | Hsp90 co-chaperone Cdc37 (Hsp90 chaperone protein kinase-targeting subunit) (p50Cdc37) [Cleaved into: Hsp90 co-chaperone Cdc37, N-terminally processed] | EBI-16789709 | 0.42 |
| Q14684 | Ribosomal RNA processing protein 1 homolog B (RRP1-like protein B) | EBI-16789709 | 0.27 |
| Q14241 | Elongin-A (EloA) (Elongin 110 kDa subunit) (RNA polymerase II transcription factor SIII subunit A1) (SIII p110) (Transcription elongation factor B polypeptide 3) | EBI-16789709 | 0.27 |
| Q13823 | Nucleolar GTP-binding protein 2 (Autoantigen NGP-1) | EBI-16789709 | 0.27 |
| Q13610 | Periodic tryptophan protein 1 homolog (Keratinocyte protein IEF SSP 9502) | EBI-16789709 | 0.27 |
| Q13011 | Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial (EC 5.3.3.-) | EBI-16789709 | 0.27 |
| P55199 | RNA polymerase II elongation factor ELL (Eleven-nineteen lysine-rich leukemia protein) | EBI-16789709 | 0.27 |
| P46013 | Proliferation marker protein Ki-67 (Antigen identified by monoclonal antibody Ki-67) (Antigen KI-67) (Antigen Ki67) | EBI-16789709 | 0.48 |
| P29083 | General transcription factor IIE subunit 1 (General transcription factor IIE 56 kDa subunit) (Transcription initiation factor IIE subunit alpha) (TFIIE-alpha) | EBI-16789709 | 0.27 |
| O75683 | Surfeit locus protein 6 | EBI-16789709 | 0.27 |
| O00541 | Pescadillo homolog | EBI-16789709 | 0.27 |
| Q9Y5Q9 | General transcription factor 3C polypeptide 3 (Transcription factor IIIC 102 kDa subunit) (TFIIIC 102 kDa subunit) (TFIIIC102) (Transcription factor IIIC subunit gamma) (TF3C-gamma) | EBI-16789709 | 0.27 |
| Q9Y5Q8 | General transcription factor 3C polypeptide 5 (TF3C-epsilon) (Transcription factor IIIC 63 kDa subunit) (TFIIIC 63 kDa subunit) (TFIIIC63) (Transcription factor IIIC subunit epsilon) | EBI-16789709 | 0.27 |
| Q9Y4W2 | Ribosomal biogenesis protein LAS1L (Protein LAS1 homolog) | EBI-16789709 | 0.27 |
| Q9Y2X9 | Zinc finger protein 281 (GC-box-binding zinc finger protein 1) (Transcription factor ZBP-99) (Zinc finger DNA-binding protein 99) | EBI-16789709 | 0.27 |
| Q9Y2G7 | Zinc finger protein 30 homolog (Zfp-30) (Zinc finger protein 745) | EBI-16789709 | 0.27 |
| Q9H9Y6 | DNA-directed RNA polymerase I subunit RPA2 (RNA polymerase I subunit 2) (EC 2.7.7.6) (DNA-directed RNA polymerase I 135 kDa polypeptide) (RPA135) | EBI-16789709 | 0.27 |
| Q9H9B1 | Histone-lysine N-methyltransferase EHMT1 (EC 2.1.1.-) (EC 2.1.1.367) (Euchromatic histone-lysine N-methyltransferase 1) (Eu-HMTase1) (G9a-like protein 1) (GLP) (GLP1) (Histone H3-K9 methyltransferase 5) (H3-K9-HMTase 5) (Lysine N-methyltransferase 1D) | EBI-16789709 | 0.27 |
| Q9BYE7 | Polycomb group RING finger protein 6 (Mel18 and Bmi1-like RING finger) (RING finger protein 134) | EBI-16789709 | 0.27 |
| Q9BTC8 | Metastasis-associated protein MTA3 | EBI-16789709 | 0.27 |
| Q8IWI9 | MAX gene-associated protein (MAX dimerization protein 5) | EBI-16789709 | 0.27 |
| Q6P1X5 | Transcription initiation factor TFIID subunit 2 (150 kDa cofactor of initiator function) (RNA polymerase II TBP-associated factor subunit B) (TBP-associated factor 150 kDa) (Transcription initiation factor TFIID 150 kDa subunit) (TAF(II)150) (TAFII-150) (TAFII150) | EBI-16789709 | 0.27 |
| Q5UIP0 | Telomere-associated protein RIF1 (Rap1-interacting factor 1 homolog) | EBI-16789709 | 0.27 |
| Q15542 | Transcription initiation factor TFIID subunit 5 (Transcription initiation factor TFIID 100 kDa subunit) (TAF(II)100) (TAFII-100) (TAFII100) | EBI-16789709 | 0.27 |
| Q13206 | Probable ATP-dependent RNA helicase DDX10 (EC 3.6.4.13) (DEAD box protein 10) | EBI-16789709 | 0.27 |
| Q12789 | General transcription factor 3C polypeptide 1 (TF3C-alpha) (TFIIIC box B-binding subunit) (Transcription factor IIIC 220 kDa subunit) (TFIIIC 220 kDa subunit) (TFIIIC220) (Transcription factor IIIC subunit alpha) | EBI-16789709 | 0.27 |
| P62891 | 60S ribosomal protein L39 (Large ribosomal subunit protein eL39) | EBI-16789709 | 0.27 |
| P49848 | Transcription initiation factor TFIID subunit 6 (RNA polymerase II TBP-associated factor subunit E) (Transcription initiation factor TFIID 70 kDa subunit) (TAF(II)70) (TAFII-70) (TAFII70) (Transcription initiation factor TFIID 80 kDa subunit) (TAF(II)80) (TAFII-80) (TAFII80) | EBI-16789709 | 0.27 |
| P49642 | DNA primase small subunit (EC 2.7.7.102) (DNA primase 49 kDa subunit) (p49) | EBI-16789709 | 0.27 |
| P38432 | Coilin (p80-coilin) | EBI-16789709 | 0.27 |
| P29084 | Transcription initiation factor IIE subunit beta (TFIIE-beta) (General transcription factor IIE subunit 2) | EBI-16789709 | 0.27 |
| P21675 | Transcription initiation factor TFIID subunit 1 (EC 2.3.1.48) (EC 2.7.11.1) (Cell cycle gene 1 protein) (TBP-associated factor 250 kDa) (p250) (Transcription initiation factor TFIID 250 kDa subunit) (TAF(II)250) (TAFII-250) (TAFII250) | EBI-16789709 | 0.27 |
| O95602 | DNA-directed RNA polymerase I subunit RPA1 (RNA polymerase I subunit A1) (EC 2.7.7.6) (A190) (DNA-directed RNA polymerase I largest subunit) (DNA-directed RNA polymerase I subunit A) (RNA polymerase I 194 kDa subunit) (RPA194) | EBI-16789709 | 0.27 |
| O00268 | Transcription initiation factor TFIID subunit 4 (RNA polymerase II TBP-associated factor subunit C) (TBP-associated factor 4) (Transcription initiation factor TFIID 130 kDa subunit) (TAF(II)130) (TAFII-130) (TAFII130) (Transcription initiation factor TFIID 135 kDa subunit) (TAF(II)135) (TAFII-135) (TAFII135) | EBI-16789709 | 0.27 |
| P15927 | Replication protein A 32 kDa subunit (RP-A p32) (Replication factor A protein 2) (RF-A protein 2) (Replication protein A 34 kDa subunit) (RP-A p34) | EBI-16790014 | 0.35 |
| P56270 | Myc-associated zinc finger protein (MAZI) (Pur-1) (Purine-binding transcription factor) (Serum amyloid A-activating factor-1) (SAF-1) (Transcription factor Zif87) (ZF87) (Zinc finger protein 801) | EBI-16790014 | 0.35 |
| P0DMV8 | Heat shock 70 kDa protein 1A (Heat shock 70 kDa protein 1) (HSP70-1) (HSP70.1) | EBI-16790014 | 0.35 |
| Q7Z739 | YTH domain-containing family protein 3 (DF3) | EBI-16790014 | 0.35 |
| Q709F0 | Acyl-CoA dehydrogenase family member 11 (ACAD-11) (EC 1.3.8.-) | EBI-16790014 | 0.35 |
| P62633 | CCHC-type zinc finger nucleic acid binding protein (Cellular nucleic acid-binding protein) (CNBP) (Zinc finger protein 9) | EBI-16790014 | 0.35 |
| O15235 | 28S ribosomal protein S12, mitochondrial (MRP-S12) (S12mt) (MT-RPS12) (Mitochondrial small ribosomal subunit protein uS12m) | EBI-16790014 | 0.35 |
| Q02539 | Histone H1.1 (Histone H1a) | EBI-20913302 | 0.40 |
| P03372 | Estrogen receptor (ER) (ER-alpha) (Estradiol receptor) (Nuclear receptor subfamily 3 group A member 1) | EBI-21301141 | 0.35 |
| Q9Y2W1 | Thyroid hormone receptor-associated protein 3 (BCLAF1 and THRAP3 family member 2) (Thyroid hormone receptor-associated protein complex 150 kDa component) (Trap150) | EBI-28935791 | 0.35 |
| Q9UPE1 | SRSF protein kinase 3 (EC 2.7.11.1) (Muscle-specific serine kinase 1) (MSSK-1) (Serine/arginine-rich protein-specific kinase 3) (SR-protein-specific kinase 3) (Serine/threonine-protein kinase 23) | EBI-28935791 | 0.35 |
| Q9UHB6 | LIM domain and actin-binding protein 1 (Epithelial protein lost in neoplasm) | EBI-28935791 | 0.35 |
| Q9NYF8 | Bcl-2-associated transcription factor 1 (Btf) (BCLAF1 and THRAP3 family member 1) | EBI-28935791 | 0.35 |
| Q96SB3 | Neurabin-2 (Neurabin-II) (Protein phosphatase 1 regulatory subunit 9B) (Spinophilin) | EBI-28935791 | 0.35 |
| Q8ND56 | Protein LSM14 homolog A (Protein FAM61A) (Protein SCD6 homolog) (Putative alpha-synuclein-binding protein) (AlphaSNBP) (RNA-associated protein 55A) (hRAP55) (hRAP55A) | EBI-28935791 | 0.35 |
| Q8IUD2 | ELKS/Rab6-interacting/CAST family member 1 (ERC-1) (Rab6-interacting protein 2) | EBI-28935791 | 0.35 |
| Q86X55 | Histone-arginine methyltransferase CARM1 (EC 2.1.1.319) (Coactivator-associated arginine methyltransferase 1) (Protein arginine N-methyltransferase 4) | EBI-28935791 | 0.35 |
| Q16891 | MICOS complex subunit MIC60 (Cell proliferation-inducing gene 4/52 protein) (Mitochondrial inner membrane protein) (Mitofilin) (p87/89) | EBI-28935791 | 0.35 |
| Q16643 | Drebrin (Developmentally-regulated brain protein) | EBI-28935791 | 0.35 |
| Q01082 | Spectrin beta chain, non-erythrocytic 1 (Beta-II spectrin) (Fodrin beta chain) (Spectrin, non-erythroid beta chain 1) | EBI-28935791 | 0.35 |
| P54886 | Delta-1-pyrroline-5-carboxylate synthase (P5CS) (Aldehyde dehydrogenase family 18 member A1) [Includes: Glutamate 5-kinase (GK) (EC 2.7.2.11) (Gamma-glutamyl kinase); Gamma-glutamyl phosphate reductase (GPR) (EC 1.2.1.41) (Glutamate-5-semialdehyde dehydrogenase) (Glutamyl-gamma-semialdehyde dehydrogenase)] | EBI-28935791 | 0.35 |
| P11388 | DNA topoisomerase 2-alpha (EC 5.6.2.2) (DNA topoisomerase II, alpha isozyme) | EBI-28935791 | 0.35 |
| P0C0S5 | Histone H2A.Z (H2A/z) | EBI-28935791 | 0.35 |
| P04637 | Cellular tumor antigen p53 (Antigen NY-CO-13) (Phosphoprotein p53) (Tumor suppressor p53) | EBI-28935791 | 0.35 |
| O00763 | Acetyl-CoA carboxylase 2 (EC 6.4.1.2) (ACC-beta) | EBI-28935791 | 0.35 |
Database | Links |
| UNIPROT | P50613 Q9BS60 Q9UE19 |
| PDB | 1UA2 6O9L 6XBZ 6XD3 7B5O 7B5Q 7EGB 7EGC 7ENA 7ENC 7LBM 7NVR |
| Pfam | PF00069 |
| PROSITE | PS00107 PS50011 PS00108 |
| OMIM | 601955 |
| DisGeNET | 1022 |
National and Kapodistrian University of Athens
Department of Biology
Biophysics & Bioinformatics Laboratory