Cyclin-dependent kinase 7 - Homo sapiens

Cyclin-dependent kinase 7 (Homo sapiens)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	Cyclin-dependent kinase 7
Accession Code	P50613
Gene	CDK7
Organism	Homo sapiens \| Human (Taxonomy: 9606)
Part of Reference Proteome?	Yes
Sequence (Length: 346)
MALDVKSRAKRYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSEAKDGINRTALREIKLLQELSHPNIIGLLDA FGHKSNISLVFDFMETDLEVIIKDNSLVLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAK SFGSPNRAYTHQVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDM CSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCARITATQALKMKYFSNRPGPTPGCQLPRPNCPVETLKEQ SNPALAIKRKRTEALEQGGLPKKLIF

Structure Viewer (PDB: 7ENC)

Subcellular Location

Description
Nucleus {Experimental EvidencePubMed:10958787, Experimental EvidencePubMed:15695176, Experimental EvidencePubMed:19071173}. Cytoplasm {Experimental EvidencePubMed:15695176}. Cytoplasm, perinuclear region {Experimental EvidencePubMed:19071173}. Note=Colocalizes with PRKCI in the cytoplasm and nucleus (PubMed:15695176). Translocates from the nucleus to cytoplasm and perinuclear region in response to DNA-bound peptides (PubMed:19071173). {Experimental EvidencePubMed:15695176, Experimental EvidencePubMed:19071173}.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Unknown	UniProt	Sequence Analysis
Assigned Ontology terms

Cellular Component	CAK-ERCC2 Complex (GO:0070516) Cyclin-Dependent Protein Kinase Activating Kinase Holoenzyme Complex (GO:0019907) Cytoplasm (GO:0005737) Cytosol (GO:0005829) Fibrillar Center (GO:0001650) Male Germ Cell Nucleus (GO:0001673) Nucleoplasm (GO:0005654) Nucleus (GO:0005634) Perinuclear Region Of Cytoplasm (GO:0048471) Plasma Membrane (GO:0005886) Transcription Factor TFIIH Core Complex (GO:0000439) Transcription Factor TFIIH Holo Complex (GO:0005675) Transcription Factor TFIIK Complex (GO:0070985)

Biology & Function

Description
Serine/threonine kinase involved in cell cycle control and in RNA polymerase II-mediated RNA transcription. Cyclin-dependent kinases (CDKs) are activated by the binding to a cyclin and mediate the progression through the cell cycle. Each different complex controls a specific transition between 2 subsequent phases in the cell cycle. Required for both activation and complex formation of CDK1/cyclin-B during G2-M transition, and for activation of CDK2/cyclins during G1-S transition (but not complex formation). CDK7 is the catalytic subunit of the CDK-activating kinase (CAK) complex. Phosphorylates SPT5/SUPT5H, SF1/NR5A1, POLR2A, p53/TP53, CDK1, CDK2, CDK4, CDK6 and CDK11B/CDK11. CAK activates the cyclin-associated kinases CDK1, CDK2, CDK4 and CDK6 by threonine phosphorylation, thus regulating cell cycle progression. CAK complexed to the core-TFIIH basal transcription factor activates RNA polymerase II by serine phosphorylation of the repetitive C- terminal domain (CTD) of its large subunit (POLR2A), allowing its escape from the promoter and elongation of the transcripts (PubMed:9852112). Phosphorylation of POLR2A in complex with DNA promotes transcription initiation by triggering dissociation from DNA. Its expression and activity are constant throughout the cell cycle. Upon DNA damage, triggers p53/TP53 activation by phosphorylation, but is inactivated in turn by p53/TP53; this feedback loop may lead to an arrest of the cell cycle and of the transcription, helping in cell recovery, or to apoptosis. Required for DNA-bound peptides-mediated transcription and cellular growth inhibition. {Experimental EvidencePubMed:10024882, Experimental EvidencePubMed:11113184, Experimental EvidencePubMed:16327805, Experimental EvidencePubMed:17373709, Experimental EvidencePubMed:17386261, Experimental EvidencePubMed:17901130, Experimental EvidencePubMed:19015234, Experimental EvidencePubMed:19071173, Experimental EvidencePubMed:19136461, Experimental EvidencePubMed:19450536, Experimental EvidencePubMed:19667075, Experimental EvidencePubMed:20360007, Experimental EvidencePubMed:9372954, Experimental EvidencePubMed:9840937, Experimental EvidencePubMed:9852112}.
Assigned Ontology terms

Biological Process	Cell Cycle (GO:0007049) Cell Division (GO:0051301) DNA Repair (GO:0006281) Phosphorylation Of RNA Polymerase II C-Terminal Domain (GO:0070816) Positive Regulation Of Transcription By RNA Polymerase II (GO:0045944) Protein Phosphorylation (GO:0006468) Protein Stabilization (GO:0050821) Regulation Of Cell Cycle (GO:0051726) Regulation Of Cyclin-Dependent Protein Serine/Threonine Kinase Activity (GO:0000079) Regulation Of G1/S Transition Of Mitotic Cell Cycle (GO:2000045) SnRNA Transcription By RNA Polymerase II (GO:0042795) Transcription By RNA Polymerase II (GO:0006366) Transcription Initiation At RNA Polymerase II Promoter (GO:0006367)
Molecular Function	ATP Binding (GO:0005524) ATP-Dependent Activity, Acting On DNA (GO:0008094) Cyclin-Dependent Protein Serine/Threonine Kinase Activity (GO:0004693) Protein C-Terminus Binding (GO:0008022) Protein Kinase Activity (GO:0004672) Protein Serine Kinase Activity (GO:0106310) Protein Serine/Threonine Kinase Activity (GO:0004674) RNA Polymerase II CTD Heptapeptide Repeat Kinase Activity (GO:0008353)

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (7 interactors)

Partner (NucEnvDB)		IntAct	Confidence score
O15027	Protein transport protein Sec16A	EBI-16790014	0.35
P12270	Nucleoprotein TPR	EBI-16790014	0.35
Q9UBF8	Phosphatidylinositol 4-kinase beta	EBI-21835901	0.35
Q92621	Nuclear pore complex protein Nup205	EBI-16789709	0.27
Q13137	Calcium-binding and coiled-coil domain-containing protein 2	EBI-21835901	0.35
Q9BWU1	Cyclin-dependent kinase 19	EBI-15560892	0.44
P11802	Cyclin-dependent kinase 4	EBI-15560841	0.44
Interactions with other proteins (127 interactors)

Partner (UniProt)		IntAct	Confidence score
P51948	CDK-activating kinase assembly factor MAT1 (CDK7/cyclin-H assembly factor) (Cyclin-G1-interacting protein) (Menage a trois) (RING finger protein 66) (RING finger protein MAT1) (p35) (p36)	EBI-1245984	0.82
P51946	Cyclin-H (MO15-associated protein) (p34) (p37)	EBI-1245984	0.93
P32121	Beta-arrestin-2 (Arrestin beta-2) (Non-visual arrestin-3)	EBI-1642567	0.35
A0A380PKN3	Putative N-acetylglucosamine-6-phosphate deacetylase (EC 3.5.1.25)	EBI-2873645	0.00
P31016	Disks large homolog 4 (Postsynaptic density protein 95) (PSD-95) (Synapse-associated protein 90) (SAP-90) (SAP90)	EBI-7960638	0.44
P51659	Peroxisomal multifunctional enzyme type 2 (MFE-2) (17-beta-hydroxysteroid dehydrogenase 4) (17-beta-HSD 4) (D-bifunctional protein) (DBP) (Multifunctional protein 2) (MFP-2) (Short chain dehydrogenase/reductase family 8C member 1) [Cleaved into: (3R)-hydroxyacyl-CoA dehydrogenase (EC 1.1.1.n12); Enoyl-CoA hydratase 2 (EC 4.2.1.107) (EC 4.2.1.119) (3-alpha,7-alpha,12-alpha-trihydroxy-5-beta-cholest-24-enoyl-CoA hydratase)]	EBI-3906748	0.37
P01909	HLA class II histocompatibility antigen, DQ alpha 1 chain (DC-1 alpha chain) (DC-alpha) (HLA-DCA) (MHC class II DQA1)	EBI-3906738	0.37
P24941	Cyclin-dependent kinase 2 (EC 2.7.11.22) (Cell division protein kinase 2) (p33 protein kinase)	EBI-6255891	0.71
P01023	Alpha-2-macroglobulin (Alpha-2-M) (C3 and PZP-like alpha-2-macroglobulin domain-containing protein 5)	EBI-6380434	0.35
P32780	General transcription factor IIH subunit 1 (Basic transcription factor 2 62 kDa subunit) (BTF2 p62) (General transcription factor IIH polypeptide 1) (TFIIH basal transcription factor complex p62 subunit)	EBI-6380434	0.76
P48740	Mannan-binding lectin serine protease 1 (EC 3.4.21.-) (Complement factor MASP-3) (Complement-activating component of Ra-reactive factor) (Mannose-binding lectin-associated serine protease 1) (MASP-1) (Mannose-binding protein-associated serine protease) (Ra-reactive factor serine protease p100) (RaRF) (Serine protease 5) [Cleaved into: Mannan-binding lectin serine protease 1 heavy chain; Mannan-binding lectin serine protease 1 light chain]	EBI-6380434	0.35
P19447	General transcription and DNA repair factor IIH helicase subunit XPB (TFIIH subunit XPB) (EC 3.6.4.12) (Basic transcription factor 2 89 kDa subunit) (BTF2 p89) (DNA excision repair protein ERCC-3) (DNA repair protein complementing XP-B cells) (TFIIH basal transcription factor complex 89 kDa subunit) (TFIIH 89 kDa subunit) (TFIIH p89) (Xeroderma pigmentosum group B-complementing protein)	EBI-6380434	0.74
P18074	General transcription and DNA repair factor IIH helicase subunit XPD (TFIIH subunit XPD) (EC 3.6.4.12) (Basic transcription factor 2 80 kDa subunit) (BTF2 p80) (CXPD) (DNA excision repair protein ERCC-2) (DNA repair protein complementing XP-D cells) (TFIIH basal transcription factor complex 80 kDa subunit) (TFIIH 80 kDa subunit) (TFIIH p80) (Xeroderma pigmentosum group D-complementing protein)	EBI-6380434	0.74
Q92759	General transcription factor IIH subunit 4 (Basic transcription factor 2 52 kDa subunit) (BTF2 p52) (General transcription factor IIH polypeptide 4) (TFIIH basal transcription factor complex p52 subunit)	EBI-6380434	0.67
Q13888	General transcription factor IIH subunit 2 (Basic transcription factor 2 44 kDa subunit) (BTF2 p44) (General transcription factor IIH polypeptide 2) (TFIIH basal transcription factor complex p44 subunit)	EBI-6380434	0.67
P23634	Plasma membrane calcium-transporting ATPase 4 (PMCA4) (EC 7.2.2.10) (Matrix-remodeling-associated protein 1) (Plasma membrane calcium ATPase isoform 4) (Plasma membrane calcium pump isoform 4)	EBI-6380434	0.35
P28715	DNA excision repair protein ERCC-5 (EC 3.1.-.-) (DNA repair protein complementing XP-G cells) (Xeroderma pigmentosum group G-complementing protein)	EBI-6380434	0.67
Q13889	General transcription factor IIH subunit 3 (Basic transcription factor 2 34 kDa subunit) (BTF2 p34) (General transcription factor IIH polypeptide 3) (TFIIH basal transcription factor complex p34 subunit)	EBI-6380434	0.67
Q6ZYL4	General transcription factor IIH subunit 5 (General transcription factor IIH polypeptide 5) (TFB5 ortholog) (TFIIH basal transcription factor complex TTD-A subunit) (TFIIH subunit p8)	EBI-6380434	0.74
P78362	SRSF protein kinase 2 (EC 2.7.11.1) (SFRS protein kinase 2) (Serine/arginine-rich protein-specific kinase 2) (SR-protein-specific kinase 2) [Cleaved into: SRSF protein kinase 2 N-terminal; SRSF protein kinase 2 C-terminal]	EBI-6657590	0.59
Q96SB4	SRSF protein kinase 1 (EC 2.7.11.1) (SFRS protein kinase 1) (Serine/arginine-rich protein-specific kinase 1) (SR-protein-specific kinase 1)	EBI-6659767	0.59
P08238	Heat shock protein HSP 90-beta (HSP 90) (Heat shock 84 kDa) (HSP 84) (HSP84)	EBI-6424069	0.56
Q01094	Transcription factor E2F1 (E2F-1) (PBR3) (Retinoblastoma-associated protein 1) (RBAP-1) (Retinoblastoma-binding protein 3) (RBBP-3) (pRB-binding protein E2F-1)	EBI-6599707	0.27
Q6P1K8	General transcription factor IIH subunit 2-like protein (General transcription factor IIH polypeptide 2-like protein)	EBI-21622006	0.53
O96006	E3 SUMO-protein ligase ZBED1 (EC 2.3.2.-) (DNA replication-related element-binding factor) (Putative Ac-like transposable element) (Zinc finger BED domain-containing protein 1) (dREF homolog)	EBI-21692488	0.35
P14635	G2/mitotic-specific cyclin-B1	EBI-21835901	0.35
Q58FG0	Putative heat shock protein HSP 90-alpha A5 (Heat shock protein 90-alpha E) (Heat shock protein 90Ae)	EBI-21835901	0.35
Q96NH3	Protein broad-minded (TBC1 domain family member 32)	EBI-21835901	0.35
Q8IZL9	Cyclin-dependent kinase 20 (EC 2.7.11.22) (CDK-activating kinase p42) (CAK-kinase p42) (Cell cycle-related kinase) (Cell division protein kinase 20) (Cyclin-dependent protein kinase H) (Cyclin-kinase-activating kinase p42)	EBI-21835901	0.35
Q58FG1	Putative heat shock protein HSP 90-alpha A4 (Heat shock 90 kDa protein 1 alpha-like 2) (Heat shock protein 90-alpha D) (Heat shock protein 90Ad)	EBI-21835901	0.35
Q58FF7	Putative heat shock protein HSP 90-beta-3 (Heat shock protein 90-beta c) (Heat shock protein 90Bc)	EBI-21835901	0.35
Q58FF6	Putative heat shock protein HSP 90-beta 4	EBI-21835901	0.35
Q13451	Peptidyl-prolyl cis-trans isomerase FKBP5 (PPIase FKBP5) (EC 5.2.1.8) (51 kDa FK506-binding protein) (51 kDa FKBP) (FKBP-51) (54 kDa progesterone receptor-associated immunophilin) (Androgen-regulated protein 6) (FF1 antigen) (FK506-binding protein 5) (FKBP-5) (FKBP54) (p54) (HSP90-binding immunophilin) (Rotamase)	EBI-21835901	0.35
P46527	Cyclin-dependent kinase inhibitor 1B (Cyclin-dependent kinase inhibitor p27) (p27Kip1)	EBI-21835901	0.35
P24864	G1/S-specific cyclin-E1	EBI-21835901	0.35
P20248	Cyclin-A2 (Cyclin-A) (Cyclin A)	EBI-21835901	0.35
P07900	Heat shock protein HSP 90-alpha (EC 3.6.4.10) (Heat shock 86 kDa) (HSP 86) (HSP86) (Lipopolysaccharide-associated protein 2) (LAP-2) (LPS-associated protein 2) (Renal carcinoma antigen NY-REN-38)	EBI-21835901	0.35
P06493	Cyclin-dependent kinase 1 (CDK1) (EC 2.7.11.22) (EC 2.7.11.23) (Cell division control protein 2 homolog) (Cell division protein kinase 1) (p34 protein kinase)	EBI-15560801	0.44
P24928	DNA-directed RNA polymerase II subunit RPB1 (RNA polymerase II subunit B1) (EC 2.7.7.6) (DNA-directed RNA polymerase II subunit A) (DNA-directed RNA polymerase III largest subunit) (RNA-directed RNA polymerase II subunit RPB1) (EC 2.7.7.48)	EBI-15560781	0.44
Q6IAW3	CDK5 protein	EBI-15560872	0.44
O00267	Transcription elongation factor SPT5 (hSPT5) (DRB sensitivity-inducing factor 160 kDa subunit) (DSIF p160) (DRB sensitivity-inducing factor large subunit) (DSIF large subunit) (Tat-cotransactivator 1 protein) (Tat-CT1 protein)	EBI-15560912	0.44
P21127	Cyclin-dependent kinase 11B (EC 2.7.11.22) (Cell division cycle 2-like protein kinase 1) (CLK-1) (Cell division protein kinase 11B) (Galactosyltransferase-associated protein kinase p58/GTA) (PITSLRE serine/threonine-protein kinase CDC2L1) (p58 CLK-1)	EBI-15560932	0.44
Q9NXF1	Testis-expressed protein 10	EBI-16789709	0.27
Q96PZ0	Pseudouridylate synthase 7 homolog (EC 5.4.99.-)	EBI-16789709	0.27
Q8WUA4	General transcription factor 3C polypeptide 2 (TF3C-beta) (Transcription factor IIIC 110 kDa subunit) (TFIIIC 110 kDa subunit) (TFIIIC110) (Transcription factor IIIC subunit beta)	EBI-16789709	0.27
Q7Z4V5	Hepatoma-derived growth factor-related protein 2 (HDGF-related protein 2) (HRP-2) (Hepatoma-derived growth factor 2) (HDGF-2)	EBI-16789709	0.27
O15355	Protein phosphatase 1G (EC 3.1.3.16) (Protein phosphatase 1C) (Protein phosphatase 2C isoform gamma) (PP2C-gamma) (Protein phosphatase magnesium-dependent 1 gamma)	EBI-16789709	0.27
Q13042	Cell division cycle protein 16 homolog (Anaphase-promoting complex subunit 6) (APC6) (CDC16 homolog) (CDC16Hs) (Cyclosome subunit 6)	EBI-16789709	0.27
Q8N1G0	Zinc finger protein 687	EBI-16789709	0.27
P30260	Cell division cycle protein 27 homolog (Anaphase-promoting complex subunit 3) (APC3) (CDC27 homolog) (CDC27Hs) (H-NUC)	EBI-16789709	0.27
Q96ME7	Zinc finger protein 512	EBI-16789709	0.27
Q8TDI0	Chromodomain-helicase-DNA-binding protein 5 (CHD-5) (EC 3.6.4.12) (ATP-dependent helicase CHD5)	EBI-16789709	0.27
Q7Z5K2	Wings apart-like protein homolog (Friend of EBNA2 protein) (WAPL cohesin release factor)	EBI-16789709	0.27
Q9NW82	WD repeat-containing protein 70	EBI-16789709	0.27
Q9Y3C7	Mediator of RNA polymerase II transcription subunit 31 (Mediator complex subunit 31) (Mediator complex subunit SOH1) (hSOH1)	EBI-16789709	0.27
Q9Y2R4	Probable ATP-dependent RNA helicase DDX52 (EC 3.6.4.13) (ATP-dependent RNA helicase ROK1-like) (DEAD box protein 52)	EBI-16789709	0.27
Q9UK58	Cyclin-L1 (Cyclin-L)	EBI-16789709	0.27
Q9NY93	Probable ATP-dependent RNA helicase DDX56 (EC 3.6.4.13) (ATP-dependent 61 kDa nucleolar RNA helicase) (DEAD box protein 21) (DEAD box protein 56)	EBI-16789709	0.27
Q9NX58	Cell growth-regulating nucleolar protein	EBI-16789709	0.27
Q9NW13	RNA-binding protein 28 (RNA-binding motif protein 28)	EBI-16789709	0.27
Q9NVC6	Mediator of RNA polymerase II transcription subunit 17 (Activator-recruited cofactor 77 kDa component) (ARC77) (Cofactor required for Sp1 transcriptional activation subunit 6) (CRSP complex subunit 6) (Mediator complex subunit 17) (Thyroid hormone receptor-associated protein complex 80 kDa component) (Trap80) (Transcriptional coactivator CRSP77) (Vitamin D3 receptor-interacting protein complex 80 kDa component) (DRIP80)	EBI-16789709	0.27
Q9H0A0	RNA cytidine acetyltransferase (EC 2.3.1.-) (18S rRNA cytosine acetyltransferase) (N-acetyltransferase 10) (N-acetyltransferase-like protein) (hALP)	EBI-16789709	0.27
Q9BZE4	GTP-binding protein 4 (Chronic renal failure gene protein) (GTP-binding protein NGB) (Nucleolar GTP-binding protein 1)	EBI-16789709	0.27
Q96S94	Cyclin-L2 (Paneth cell-enhanced expression protein)	EBI-16789709	0.27
Q8TF01	Arginine/serine-rich protein PNISR (PNN-interacting serine/arginine-rich protein) (SR-related protein) (SR-rich protein) (Serine/arginine-rich-splicing regulatory protein 130) (SRrp130) (Splicing factor, arginine/serine-rich 130) (Splicing factor, arginine/serine-rich 18)	EBI-16789709	0.27
Q8IY81	pre-rRNA 2'-O-ribose RNA methyltransferase FTSJ3 (EC 2.1.1.-) (Protein ftsJ homolog 3) (Putative rRNA methyltransferase 3)	EBI-16789709	0.27
Q8IX01	SURP and G-patch domain-containing protein 2 (Arginine/serine-rich-splicing factor 14) (Splicing factor, arginine/serine-rich 14)	EBI-16789709	0.27
Q6PD62	RNA polymerase-associated protein CTR9 homolog (SH2 domain-binding protein 1)	EBI-16789709	0.27
Q16543	Hsp90 co-chaperone Cdc37 (Hsp90 chaperone protein kinase-targeting subunit) (p50Cdc37) [Cleaved into: Hsp90 co-chaperone Cdc37, N-terminally processed]	EBI-16789709	0.42
Q14684	Ribosomal RNA processing protein 1 homolog B (RRP1-like protein B)	EBI-16789709	0.27
Q14241	Elongin-A (EloA) (Elongin 110 kDa subunit) (RNA polymerase II transcription factor SIII subunit A1) (SIII p110) (Transcription elongation factor B polypeptide 3)	EBI-16789709	0.27
Q13823	Nucleolar GTP-binding protein 2 (Autoantigen NGP-1)	EBI-16789709	0.27
Q13610	Periodic tryptophan protein 1 homolog (Keratinocyte protein IEF SSP 9502)	EBI-16789709	0.27
Q13011	Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial (EC 5.3.3.-)	EBI-16789709	0.27
P55199	RNA polymerase II elongation factor ELL (Eleven-nineteen lysine-rich leukemia protein)	EBI-16789709	0.27
P46013	Proliferation marker protein Ki-67 (Antigen identified by monoclonal antibody Ki-67) (Antigen KI-67) (Antigen Ki67)	EBI-16789709	0.48
P29083	General transcription factor IIE subunit 1 (General transcription factor IIE 56 kDa subunit) (Transcription initiation factor IIE subunit alpha) (TFIIE-alpha)	EBI-16789709	0.27
O75683	Surfeit locus protein 6	EBI-16789709	0.27
O00541	Pescadillo homolog	EBI-16789709	0.27
Q9Y5Q9	General transcription factor 3C polypeptide 3 (Transcription factor IIIC 102 kDa subunit) (TFIIIC 102 kDa subunit) (TFIIIC102) (Transcription factor IIIC subunit gamma) (TF3C-gamma)	EBI-16789709	0.27
Q9Y5Q8	General transcription factor 3C polypeptide 5 (TF3C-epsilon) (Transcription factor IIIC 63 kDa subunit) (TFIIIC 63 kDa subunit) (TFIIIC63) (Transcription factor IIIC subunit epsilon)	EBI-16789709	0.27
Q9Y4W2	Ribosomal biogenesis protein LAS1L (Protein LAS1 homolog)	EBI-16789709	0.27
Q9Y2X9	Zinc finger protein 281 (GC-box-binding zinc finger protein 1) (Transcription factor ZBP-99) (Zinc finger DNA-binding protein 99)	EBI-16789709	0.27
Q9Y2G7	Zinc finger protein 30 homolog (Zfp-30) (Zinc finger protein 745)	EBI-16789709	0.27
Q9H9Y6	DNA-directed RNA polymerase I subunit RPA2 (RNA polymerase I subunit 2) (EC 2.7.7.6) (DNA-directed RNA polymerase I 135 kDa polypeptide) (RPA135)	EBI-16789709	0.27
Q9H9B1	Histone-lysine N-methyltransferase EHMT1 (EC 2.1.1.-) (EC 2.1.1.367) (Euchromatic histone-lysine N-methyltransferase 1) (Eu-HMTase1) (G9a-like protein 1) (GLP) (GLP1) (Histone H3-K9 methyltransferase 5) (H3-K9-HMTase 5) (Lysine N-methyltransferase 1D)	EBI-16789709	0.27
Q9BYE7	Polycomb group RING finger protein 6 (Mel18 and Bmi1-like RING finger) (RING finger protein 134)	EBI-16789709	0.27
Q9BTC8	Metastasis-associated protein MTA3	EBI-16789709	0.27
Q8IWI9	MAX gene-associated protein (MAX dimerization protein 5)	EBI-16789709	0.27
Q6P1X5	Transcription initiation factor TFIID subunit 2 (150 kDa cofactor of initiator function) (RNA polymerase II TBP-associated factor subunit B) (TBP-associated factor 150 kDa) (Transcription initiation factor TFIID 150 kDa subunit) (TAF(II)150) (TAFII-150) (TAFII150)	EBI-16789709	0.27
Q5UIP0	Telomere-associated protein RIF1 (Rap1-interacting factor 1 homolog)	EBI-16789709	0.27
Q15542	Transcription initiation factor TFIID subunit 5 (Transcription initiation factor TFIID 100 kDa subunit) (TAF(II)100) (TAFII-100) (TAFII100)	EBI-16789709	0.27
Q13206	Probable ATP-dependent RNA helicase DDX10 (EC 3.6.4.13) (DEAD box protein 10)	EBI-16789709	0.27
Q12789	General transcription factor 3C polypeptide 1 (TF3C-alpha) (TFIIIC box B-binding subunit) (Transcription factor IIIC 220 kDa subunit) (TFIIIC 220 kDa subunit) (TFIIIC220) (Transcription factor IIIC subunit alpha)	EBI-16789709	0.27
P62891	60S ribosomal protein L39 (Large ribosomal subunit protein eL39)	EBI-16789709	0.27
P49848	Transcription initiation factor TFIID subunit 6 (RNA polymerase II TBP-associated factor subunit E) (Transcription initiation factor TFIID 70 kDa subunit) (TAF(II)70) (TAFII-70) (TAFII70) (Transcription initiation factor TFIID 80 kDa subunit) (TAF(II)80) (TAFII-80) (TAFII80)	EBI-16789709	0.27
P49642	DNA primase small subunit (EC 2.7.7.102) (DNA primase 49 kDa subunit) (p49)	EBI-16789709	0.27
P38432	Coilin (p80-coilin)	EBI-16789709	0.27
P29084	Transcription initiation factor IIE subunit beta (TFIIE-beta) (General transcription factor IIE subunit 2)	EBI-16789709	0.27
P21675	Transcription initiation factor TFIID subunit 1 (EC 2.3.1.48) (EC 2.7.11.1) (Cell cycle gene 1 protein) (TBP-associated factor 250 kDa) (p250) (Transcription initiation factor TFIID 250 kDa subunit) (TAF(II)250) (TAFII-250) (TAFII250)	EBI-16789709	0.27
O95602	DNA-directed RNA polymerase I subunit RPA1 (RNA polymerase I subunit A1) (EC 2.7.7.6) (A190) (DNA-directed RNA polymerase I largest subunit) (DNA-directed RNA polymerase I subunit A) (RNA polymerase I 194 kDa subunit) (RPA194)	EBI-16789709	0.27
O00268	Transcription initiation factor TFIID subunit 4 (RNA polymerase II TBP-associated factor subunit C) (TBP-associated factor 4) (Transcription initiation factor TFIID 130 kDa subunit) (TAF(II)130) (TAFII-130) (TAFII130) (Transcription initiation factor TFIID 135 kDa subunit) (TAF(II)135) (TAFII-135) (TAFII135)	EBI-16789709	0.27
P15927	Replication protein A 32 kDa subunit (RP-A p32) (Replication factor A protein 2) (RF-A protein 2) (Replication protein A 34 kDa subunit) (RP-A p34)	EBI-16790014	0.35
P56270	Myc-associated zinc finger protein (MAZI) (Pur-1) (Purine-binding transcription factor) (Serum amyloid A-activating factor-1) (SAF-1) (Transcription factor Zif87) (ZF87) (Zinc finger protein 801)	EBI-16790014	0.35
P0DMV8	Heat shock 70 kDa protein 1A (Heat shock 70 kDa protein 1) (HSP70-1) (HSP70.1)	EBI-16790014	0.35
Q7Z739	YTH domain-containing family protein 3 (DF3)	EBI-16790014	0.35
Q709F0	Acyl-CoA dehydrogenase family member 11 (ACAD-11) (EC 1.3.8.-)	EBI-16790014	0.35
P62633	CCHC-type zinc finger nucleic acid binding protein (Cellular nucleic acid-binding protein) (CNBP) (Zinc finger protein 9)	EBI-16790014	0.35
O15235	28S ribosomal protein S12, mitochondrial (MRP-S12) (S12mt) (MT-RPS12) (Mitochondrial small ribosomal subunit protein uS12m)	EBI-16790014	0.35
Q02539	Histone H1.1 (Histone H1a)	EBI-20913302	0.40
P03372	Estrogen receptor (ER) (ER-alpha) (Estradiol receptor) (Nuclear receptor subfamily 3 group A member 1)	EBI-21301141	0.35
Q9Y2W1	Thyroid hormone receptor-associated protein 3 (BCLAF1 and THRAP3 family member 2) (Thyroid hormone receptor-associated protein complex 150 kDa component) (Trap150)	EBI-28935791	0.35
Q9UPE1	SRSF protein kinase 3 (EC 2.7.11.1) (Muscle-specific serine kinase 1) (MSSK-1) (Serine/arginine-rich protein-specific kinase 3) (SR-protein-specific kinase 3) (Serine/threonine-protein kinase 23)	EBI-28935791	0.35
Q9UHB6	LIM domain and actin-binding protein 1 (Epithelial protein lost in neoplasm)	EBI-28935791	0.35
Q9NYF8	Bcl-2-associated transcription factor 1 (Btf) (BCLAF1 and THRAP3 family member 1)	EBI-28935791	0.35
Q96SB3	Neurabin-2 (Neurabin-II) (Protein phosphatase 1 regulatory subunit 9B) (Spinophilin)	EBI-28935791	0.35
Q8ND56	Protein LSM14 homolog A (Protein FAM61A) (Protein SCD6 homolog) (Putative alpha-synuclein-binding protein) (AlphaSNBP) (RNA-associated protein 55A) (hRAP55) (hRAP55A)	EBI-28935791	0.35
Q8IUD2	ELKS/Rab6-interacting/CAST family member 1 (ERC-1) (Rab6-interacting protein 2)	EBI-28935791	0.35
Q86X55	Histone-arginine methyltransferase CARM1 (EC 2.1.1.319) (Coactivator-associated arginine methyltransferase 1) (Protein arginine N-methyltransferase 4)	EBI-28935791	0.35
Q16891	MICOS complex subunit MIC60 (Cell proliferation-inducing gene 4/52 protein) (Mitochondrial inner membrane protein) (Mitofilin) (p87/89)	EBI-28935791	0.35
Q16643	Drebrin (Developmentally-regulated brain protein)	EBI-28935791	0.35
Q01082	Spectrin beta chain, non-erythrocytic 1 (Beta-II spectrin) (Fodrin beta chain) (Spectrin, non-erythroid beta chain 1)	EBI-28935791	0.35
P54886	Delta-1-pyrroline-5-carboxylate synthase (P5CS) (Aldehyde dehydrogenase family 18 member A1) [Includes: Glutamate 5-kinase (GK) (EC 2.7.2.11) (Gamma-glutamyl kinase); Gamma-glutamyl phosphate reductase (GPR) (EC 1.2.1.41) (Glutamate-5-semialdehyde dehydrogenase) (Glutamyl-gamma-semialdehyde dehydrogenase)]	EBI-28935791	0.35
P11388	DNA topoisomerase 2-alpha (EC 5.6.2.2) (DNA topoisomerase II, alpha isozyme)	EBI-28935791	0.35
P0C0S5	Histone H2A.Z (H2A/z)	EBI-28935791	0.35
P04637	Cellular tumor antigen p53 (Antigen NY-CO-13) (Phosphoprotein p53) (Tumor suppressor p53)	EBI-28935791	0.35
O00763	Acetyl-CoA carboxylase 2 (EC 6.4.1.2) (ACC-beta)	EBI-28935791	0.35

Cross-References

Database	Links
UNIPROT	P50613 Q9BS60 Q9UE19
PDB	1UA2 6O9L 6XBZ 6XD3 7B5O 7B5Q 7EGB 7EGC 7ENA 7ENC 7LBM 7NVR
Pfam	PF00069
PROSITE	PS00107 PS50011 PS00108
OMIM	601955
DisGeNET	1022

Cyclin-dependent kinase 7 (Homo sapiens)

General Information

Protein Information

Structure Viewer (PDB: 7ENC)

Subcellular Location

Description Show

Position in the Nuclear Envelope

Membrane Topology

Assigned Ontology terms

Biology & Function

Description Hide

Assigned Ontology terms

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (7 interactors)

Interactions with other proteins (127 interactors)

Cross-References

Database

Links

Description

Description