NucEnvDB

NucEnvDB

A database of Nuclear Envelope Proteins and their Interactions

Interferon-induced GTP-binding protein Mx1 - Bos taurus - NucEnvDB

Interferon-induced GTP-binding protein Mx1 (Bos taurus)

FASTA TEXT XML

Subcellular Location Biology & Function Cross-References

General Information

Protein Information
Protein Name	Interferon-induced GTP-binding protein Mx1
Accession Code	P79135
Gene	MX1
Organism	Bos taurus \| Cattle (Taxonomy: 9913)
Part of Reference Proteome?	Yes
Sequence (Length: 648)
MVHSDLGIEELDSPESSLNGSEDMESKSNLYSQYEEKVRPCIDLIDSLRSLGVEQDLALPAIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLVLRLKKLGNEDEWKGKVSFLDKEIEIPDASQVEK EISEAQIAIAGEGTGISHELISLEVSSPHVPDLTLIDLPGITRVAVGNQPPDIEYQIKSLIRKYILRQETINLVVVPANVDIATTEALRMAQEVDPQGDRTIGILTKPDLVDKGTEDKVVDVVRNLVFHL KKGYMIVKCRGQQDIKHRMSLDKALQRERIFFEDHAHFRDLLEEGKATIPCLAERLTSELIMHICKTLPLLENQIKETHQRITEELQKYGKDIPEEESEKMFCLIEKIDTFNKEIISTIEGEEFVEQYDS RLFTKVRAEFSKWSAVVEKNFEKGYEAIRKEIKQFENRYRGRELPGFVNYKTFETIIKKQVRVLEEPAVDMLHTVTDIIRNTFTDVSGKHFNEFFNLHRTAKSKIEDIRLEQENEAEKSIRLHFQMEQLV YCQDQVYRRALQQVREKEAEEEKNKKSNHYFQSQVSEPSTDEIFQHLTAYQQEVSTRISGHIPLIIQFFVLRTYGEQLKKSMLQLLQDKDQYDWLLKERTDTRDKRKFLKERLERLTRARQRLAKFPG

Subcellular Location

Description
Cytoplasm {Experimental EvidencePubMed:19951175}. Endoplasmic reticulum membrane {By SimilarityUniProtKB:P20591}; Peripheral membrane protein {By SimilarityUniProtKB:P20591}; Cytoplasmic side {By SimilarityUniProtKB:P20591}. Cytoplasm, perinuclear region {By SimilarityUniProtKB:P20591}. Note=Binds preferentially to negatively charged phospholipids. Colocalizes with CCHFV protein N in the perinuclear region. {By SimilarityUniProtKB:P20591}. [Isoform 2]: Nucleus {Experimental EvidencePubMed:19951175}.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Peripheral	UniProt	By Similarity {ECO:0000250\|UniProtKB:P20591}
Assigned Ontology terms

Cellular Component	Cytoplasm (GO:0005737) Cytosol (GO:0005829) Endoplasmic Reticulum Membrane (GO:0005789) Membrane (GO:0016020) Microtubule (GO:0005874) Nuclear Membrane (GO:0031965) Nucleus (GO:0005634) Perinuclear Region Of Cytoplasm (GO:0048471)

Biology & Function

Description
Interferon-induced dynamin-like GTPase with antiviral activity against rabies virus (RABV), vesicular stomatitis virus (VSV) and murine pneumonia virus (MPV). Isoform 1 but not isoform 2 shows antiviral activity against vesicular stomatitis virus (VSV). {Experimental EvidencePubMed:16202617, Experimental EvidencePubMed:19951175, Experimental EvidencePubMed:22385204}.
Assigned Ontology terms

Biological Process	Antiviral Innate Immune Response (GO:0140374) Defense Response To Virus (GO:0051607) Innate Immune Response (GO:0045087) Interleukin-27-Mediated Signaling Pathway (GO:0070106) Negative Regulation Of Viral Genome Replication (GO:0045071) Response To Type I Interferon (GO:0034340) Response To Type III Interferon (GO:0034342) Response To Virus (GO:0009615)
Molecular Function	GTP Binding (GO:0005525) GTPase Activity (GO:0003924) Identical Protein Binding (GO:0042802) Microtubule Binding (GO:0008017)

Cross-References

Database	Links
UNIPROT	P79135 O46623 Q17QZ1 Q53ZW3 Q867D5
Pfam	PF01031 PF00350 PF02212
PROSITE	PS00410 PS51718 PS51388

Powered by W3.css | Privacy Notice

x

This website uses cookies to improve user experience. By using NucEnvDB you consent to all cookies in accordance with our privacy policy. OK