NucEnvDB

NucEnvDB

A database of Nuclear Envelope Proteins and their Interactions

Nuclear envelope protein YPR174C - Saccharomyces cerevisiae S288C - NucEnvDB

Nuclear envelope protein YPR174C (Saccharomyces cerevisiae S288C)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	Nuclear envelope protein YPR174C
Accession Code	Q06616
Gene	YPR174C
Organism	Saccharomyces cerevisiae S288C (Taxonomy: 559292)
Part of Reference Proteome?	Yes
Sequence (Length: 221)
MGIQEKTLGIRKERKLVVVPRERNHVRHASQRTRSKNYKNISKKRAQQHAFGFNIAKTLAKIQAFVWGSPADEEEESVVPLSKNSQDCVPLQWQAKFAQLRQQLHSTQKELQFVKEKCHLLQSVLDDANI DQRYLESRRDMKNIERDNLKPTENLPPSPVRAVNPLVTSSPIHMSPLQSRQRPVSSLQPPKGPNFYAKYPKLPQTNILRESPTEDSVPHAE

Subcellular Location

Description
Nucleus membrane; Peripheral membrane protein. Cytoplasm, cytoskeleton, microtubule organizing center, spindle pole body.
Position in the Nuclear Envelope
Location	Location ID	Description
Nuclear Envelope	SL-0178	The nuclear envelope is a membrane system which surrounds the nucleoplasm of eukaryotic cells. It is composed of the nuclear lamina, nuclear pore complexes and two nuclear membranes. The space between the two membranes is called the nuclear intermembrane space.
Nuclear Membrane	SL-0182	The membrane surrounding the nucleus. This term is used when it is not known if the protein is found in or associated with the inner or outer nuclear membrane.
Membrane Topology
Topology	Source	Annotation Type
Peripheral	UniProt	Sequence Analysis
Assigned Ontology terms

Cellular Component	Cytoplasm (GO:0005737) Nuclear Envelope (GO:0005635) Nuclear Membrane (GO:0031965) Nuclear Periphery (GO:0034399) Spindle Pole Body (GO:0005816)

Biology & Function

Description
Specialized component of the nuclear membrane that may be involved in the connection of the spindle pole body (SPB) to the nuclear envelope. {Experimental EvidencePubMed:15282802}.
Assigned Ontology terms

Biological Process
Molecular Function

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (3 interactors)

Partner (NucEnvDB)		IntAct	Confidence score
P40069	Importin subunit beta-4	EBI-794693	0.53
Q8N6L0	Protein KASH5	EBI-11535750	0.56
P47069	Spindle pole body assembly component MPS3	EBI-2342813	0.37
Interactions with other proteins (10 interactors)

Partner (UniProt)		IntAct	Confidence score
P07259	Protein URA2 [Includes: Glutamine-dependent carbamoyl-phosphate synthase (EC 6.3.5.5); Aspartate carbamoyltransferase (EC 2.1.3.2)]	EBI-794693	0.35
P28003	SWIRM domain-containing protein FUN19	EBI-815383	0.27
Q12449	Hsp90 co-chaperone AHA1 (Activator of Hsp90 ATPase protein 1)	EBI-818622	0.27
Q03860	Golgi apparatus membrane protein TVP15 (TLG2 compartment vesicle protein 15) (TLG2-vesicle protein of 15 kDa)	EBI-2343097	0.37
P53174	Pheromone-regulated membrane protein 8 (DUP240 protein PRM8) (Protein DUP1)	EBI-2343694	0.37
P08456	CDP-diacylglycerol--serine O-phosphatidyltransferase (EC 2.7.8.8) (Phosphatidylserine synthase)	EBI-2347113	0.37
P32562	Cell cycle serine/threonine-protein kinase CDC5/MSD2 (EC 2.7.11.21)	EBI-2347516	0.37
P40578	Protein MGA2	EBI-2347625	0.37
Q5SW96	Low density lipoprotein receptor adapter protein 1 (Autosomal recessive hypercholesterolemia protein)	EBI-11535739	0.56
Q969F0	Fetal and adult testis-expressed transcript protein (Cancer/testis antigen 43) (CT43) (Tumor antigen BJ-HCC-2)	EBI-11535759	0.56

Cross-References

Database	Links
UNIPROT	Q06616 D6W4H5
Pfam	PF08537

Powered by W3.css | Privacy Notice

x

This website uses cookies to improve user experience. By using NucEnvDB you consent to all cookies in accordance with our privacy policy. OK