NucEnvDB

NucEnvDB

A database of Nuclear Envelope Proteins and their Interactions

Embryonic developmental protein tofu-6 - Caenorhabditis elegans - NucEnvDB

Embryonic developmental protein tofu-6 (Caenorhabditis elegans)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	Embryonic developmental protein tofu-6
Accession Code	Q09293
Gene	tofu
Organism	Caenorhabditis elegans (Taxonomy: 6239)
Part of Reference Proteome?	Yes
Sequence (Length: 367)
MASSSTAYYLKDAGFHIRNIPKAWNDWNLFHVFQNFGKVSYCRVVGQSNDGQVQLGFVNMMSVADADEVRKNLNDGNLIG ENFTLKVTDHKNVGGSLLPMASNSVQKLVSSPPSKSGPVLLSSSWLPLNKDIEVEVVDYLPSSSVAPDLFALTLLRINDS SMKEKYDSMHEKMNAYAQIVPFDSELEIGYDGVFRDAPRSVRRVRRISATKLYLVDFGKIINYEKAKCFQLPKVFQSMPT RVSLCGLDGLTWSPVAIPSFDNIREVVKKWGQMENSTLHAMACGFQGSINMINLFCGKSILADRLQRKGVCEYLPRSQQP HYAYSRETLLQHNNSGVTAQISNDADVVKDLLKKIDGVKNMLRELEL

Structure Viewer (PDB: 7D2Y)

Subcellular Location

Description
Cytoplasm {Experimental EvidencePubMed:31147388, Experimental EvidencePubMed:31216475}. Cytoplasm, perinuclear region {Experimental EvidencePubMed:31147388, Experimental EvidencePubMed:31216475}. Nucleus {Experimental EvidencePubMed:31216475}. Note=Dispersedly distributes throughout the cytoplasm in early embryos (PubMed:31147388). During early embryogenesis, localizes to the nucleus at prophase of cell division, and remains in the cytosol at interphase in 2- and 4-cell embryos (PubMed:31216475). Does not localize to cytoplasmic granules in oocytes and embryos (PubMed:31216475). Localizes to puncta in the perinuclear region in the germline syncytium (PubMed:31147388, PubMed:31216475). Localization to the perinuclear region in the germline is dependent on pid-1, tost-1, pics-1 and erh-2 (PubMed:31216475). {Experimental EvidencePubMed:31147388, Experimental EvidencePubMed:31216475}.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Unknown	UniProt	Sequence Analysis
Assigned Ontology terms

Cellular Component	Cytoplasm (GO:0005737) Nucleus (GO:0005634) Perinuclear Region Of Cytoplasm (GO:0048471) RNA Cap Binding Complex (GO:0034518)

Biology & Function

Description
Component of the pid-1 and tost-1 variants of the PETISCO complexes, which have roles in the biogenesis of a class of 21 nucleotide PIWI-interacting RNAs (piRNAs) that possess a uracil residue at the 5'-end (also called 21U-RNAs) and embryogenesis, respectively (PubMed:31147388, PubMed:31216475). Promotes the biogenesis of 21U-RNAs (PubMed:31216475). Required for chromosome segregation and cell division in early embryos (PubMed:17171368, PubMed:31216475). May have a role in DNA replication (PubMed:17171368). {Experimental EvidencePubMed:17171368, Experimental EvidencePubMed:31147388, Experimental EvidencePubMed:31216475, Curator InferencePubMed:31216475}.
Assigned Ontology terms

Biological Process	21U-RNA Metabolic Process (GO:0034585) Cell Division (GO:0051301) DNA Replication (GO:0006260) Embryo Development Ending In Birth Or Egg Hatching (GO:0009792) Embryonic Cleavage (GO:0040016) RNA-Mediated Gene Silencing (GO:0031047) Mitotic Sister Chromatid Separation (GO:0051306) Positive Regulation Of Cell Division (GO:0051781) Positive Regulation Of Chromosome Segregation (GO:0051984)
Molecular Function	RNA Binding (GO:0003723)

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (4 interactors)

Partner (NucEnvDB)		IntAct	Confidence score
Q20057	Enhancer of rudimentary homolog 2	EBI-21449069	0.35
O61955	Eukaryotic translation initiation factor 4E-3	EBI-21449250	0.52
Q19541	Protein pid-1	EBI-21448974	0.46
O76616	Protein pid-3	EBI-2415585	0.68
Interactions with other proteins (6 interactors)

Partner (UniProt)		IntAct	Confidence score
Q17973	RNAi-Induced Longevity	EBI-2413298	0.49
Q20660	SHSP domain-containing protein	EBI-2415578	0.49
Q18244	CCHC-type domain-containing protein	EBI-21449250	0.35
Q18490	Protein tost-1 (Twenty one u antagonist 1)	EBI-21449250	0.35
O45551	Eukaryotic translation initiation factor 4E-1 (eIF-4E-1) (eIF4E-1) (eIF-4F 25 kDa subunit) (mRNA cap-binding protein)	EBI-21449250	0.35
Q17339	Female germline-specific tumor suppressor gld-1 (Defective in germ line development protein 1)	EBI-21449250	0.35

Cross-References

Database	Links
UNIPROT	Q09293 Q9BMU5
PDB	7D1L 7D2Y 7OCX
Pfam	PF00076
PROSITE	PS50102

Powered by W3.css | Privacy Notice

x

This website uses cookies to improve user experience. By using NucEnvDB you consent to all cookies in accordance with our privacy policy. OK