Serine incorporator 3 - Homo sapiens

Serine incorporator 3 (Homo sapiens)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	Serine incorporator 3
Accession Code	Q13530
Gene	SERINC3
Organism	Homo sapiens \| Human (Taxonomy: 9606)
Part of Reference Proteome?	Yes
Sequence (Length: 473)
MGAVLGVFSLASWVPCLCSGASCLLCSCCPNSKNSTVTRLIYAFILLLSTVVSYIMQRKEMETYLKKIPGFCEGGFKIHEADINADKDCDVLVGYKAVYRISFAMAIFFFVFSLLMFKVKTSKDLRAAVH NGFWFFKIAALIGIMVGSFYIPGGYFSSVWFVVGMIGAALFILIQLVLLVDFAHSWNESWVNRMEEGNPRLWYAALLSFTSAFYILSIICVGLLYTYYTKPDGCTENKFFISINLILCVVASIISIHPKI QEHQPRSGLLQSSLITLYTMYLTWSAMSNEPDRSCNPNLMSFITRITAPTLAPGNSTAVVPTPTPPSKSGSLLDSDNFIGLFVFVLCLLYSSIRTSTNSQVDKLTLSGSDSVILGDTTTSGASDEEDGQP RRAVDNEKEGVQYSYSLFHLMLCLASLYIMMTLTSWYSPDAKFQSMTSKWPAVWVKISSSWVCLLLYVWTLVAPLVLTSRDFS

Subcellular Location

Description
Cell membrane {By SimilarityUniProtKB:Q86VE9}; Multi-pass membrane protein {Sequence Analysis}. Golgi apparatus membrane {By SimilarityUniProtKB:Q9QZI9}; Multi-pass membrane protein {By SimilarityUniProtKB:Q9QZI9}. Cytoplasm, perinuclear region {ECO:0000305\|PubMed:26416734}. Note=(Microbial infection) Upon HIV-1 infection, it is redirected to perinuclear region following interaction with HIV-1 Nef, excluding it from virions particles, thereby preventing subsequent antiviral defense activity (Probable). {ECO:0000305\|PubMed:26416734}.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Transmembrane	UniProt	Sequence Analysis {ECO:0000255}
Assigned Ontology terms

Cellular Component	Golgi Membrane (GO:0000139) Membrane (GO:0016020) Perinuclear Region Of Cytoplasm (GO:0048471) Plasma Membrane (GO:0005886)

Biology & Function

Description
Restriction factor required to restrict infectivity of lentiviruses, such as HIV-1: acts by inhibiting an early step of viral infection. Impairs the penetration of the viral particle into the cytoplasm (PubMed:26416733, PubMed:26416734). {Experimental EvidencePubMed:26416733, Experimental EvidencePubMed:26416734}.
Assigned Ontology terms

Biological Process	Defense Response To Virus (GO:0051607) Detection Of Virus (GO:0009597) Innate Immune Response (GO:0045087) L-Serine Biosynthetic Process (GO:0006564) Phosphatidylserine Metabolic Process (GO:0006658) Positive Regulation Of Endoplasmic Reticulum Stress-Induced Intrinsic Apoptotic Signaling Pathway (GO:1902237) Sphingolipid Metabolic Process (GO:0006665)
Molecular Function	L-Serine Transmembrane Transporter Activity (GO:0015194)

Protein-Protein Interactions

Interactions with other proteins (18 interactors)

Partner (UniProt)		IntAct	Confidence score
O15260	Surfeit locus protein 4	EBI-1059797	0.00
P24390	ER lumen protein-retaining receptor 1 (KDEL endoplasmic reticulum protein retention receptor 1) (KDEL receptor 1) (Putative MAPK-activating protein PM23)	EBI-1059822	0.00
Q99623	Prohibitin-2 (B-cell receptor-associated protein BAP37) (D-prohibitin) (Repressor of estrogen receptor activity)	EBI-1061397	0.00
Q9P035	Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 3 (EC 4.2.1.134) (3-hydroxyacyl-CoA dehydratase 3) (HACD3) (Butyrate-induced protein 1) (B-ind1) (hB-ind1) (Protein-tyrosine phosphatase-like A domain-containing protein 1)	EBI-1078346	0.00
P53985	Monocarboxylate transporter 1 (MCT 1) (Solute carrier family 16 member 1)	EBI-1081007	0.00
Q9Y277	Voltage-dependent anion-selective channel protein 3 (VDAC-3) (hVDAC3) (Outer mitochondrial membrane protein porin 3)	EBI-1082606	0.00
P33947	ER lumen protein-retaining receptor 2 (ERD2-like protein 1) (ELP-1) (KDEL endoplasmic reticulum protein retention receptor 2) (KDEL receptor 2)	EBI-1083230	0.00
Q9HAV4	Exportin-5 (Exp5) (Ran-binding protein 21)	EBI-1085165	0.00
P45880	Voltage-dependent anion-selective channel protein 2 (VDAC-2) (hVDAC2) (Outer mitochondrial membrane protein porin 2)	EBI-1086232	0.00
P62841	40S ribosomal protein S15 (RIG protein) (Small ribosomal subunit protein uS19)	EBI-3915396	0.37
O95393	Bone morphogenetic protein 10 (BMP-10)	EBI-3922519	0.37
A0A286YCX6	Trafficking protein particle complex 8	EBI-11119288	0.35
P30556	Type-1 angiotensin II receptor (AT1AR) (AT1BR) (Angiotensin II type-1 receptor) (AT1 receptor)	EBI-20802983	0.37
P14416	D(2) dopamine receptor (Dopamine D2 receptor)	EBI-20805908	0.37
Q13263	Transcription intermediary factor 1-beta (TIF1-beta) (E3 SUMO-protein ligase TRIM28) (EC 2.3.2.27) (KRAB-associated protein 1) (KAP-1) (KRAB-interacting protein 1) (KRIP-1) (Nuclear corepressor KAP-1) (RING finger protein 96) (RING-type E3 ubiquitin transferase TIF1-beta) (Tripartite motif-containing protein 28)	EBI-20929800	0.40
P28799	Progranulin (PGRN) (Acrogranin) (Epithelin precursor) (Glycoprotein of 88 Kda) (GP88) (Glycoprotein 88) (Granulin precursor) (PC cell-derived growth factor) (PCDGF) (Proepithelin) (PEPI) [Cleaved into: Paragranulin; Granulin-1 (Granulin G); Granulin-2 (Granulin F); Granulin-3 (Epithelin-2) (Granulin B); Granulin-4 (Epithelin-1) (Granulin A); Granulin-5 (Granulin C); Granulin-6 (Granulin D); Granulin-7 (Granulin E)]	EBI-25860965	0.56
O43933	Peroxisome biogenesis factor 1 (Peroxin-1) (Peroxisome biogenesis disorder protein 1)	EBI-25881831	0.56
O76024	Wolframin	EBI-25898215	0.56

Cross-References

Database	Links
UNIPROT	Q13530 B4DUE9 O43717 Q9BR33
Pfam	PF03348
OMIM	607165
DisGeNET	10955

NucEnvDB

NucEnvDB

A database of Nuclear Envelope Proteins and their Interactions

Serine incorporator 3 (Homo sapiens)

General Information

Protein Information

Subcellular Location

Description

Position in the Nuclear Envelope

Membrane Topology

Assigned Ontology terms

Biology & Function

Description

Assigned Ontology terms

Protein-Protein Interactions

Interactions with other proteins (18 interactors)

Cross-References

Database

Links

Serine incorporator 3 (Homo sapiens)

General Information

Protein Information

Subcellular Location

Description Show

Position in the Nuclear Envelope

Membrane Topology

Assigned Ontology terms

Biology & Function

Description Hide

Assigned Ontology terms

Protein-Protein Interactions

Interactions with other proteins (18 interactors)

Cross-References

Database

Links

Description

Description