Protein Information |
|
---|---|
Protein Name | Dynactin subunit 1 |
Accession Code | Q14203 |
Gene | DCTN1 |
Organism | Homo sapiens | Human (Taxonomy: 9606) |
Part of Reference Proteome? | Yes |
Sequence (Length: 1278) | |
MAQSKRHVYSRTPSGSRMSAEASARPLRVGSRVEVIGKGHRGTVAYVGATLFATGKWVGVILDEAKGKNDGTVQGRKYFT CDEGHGIFVRQSQIQVFEDGADTTSPETPDSSASKVLKREGTDTTAKTSKLRGLKPKKAPTARKTTTRRPKPTRPASTGV AGASSSLGPSGSASAGELSSSEPSTPAQTPLAAPIIPTPVLTSPGAVPPLPSPSKEEEGLRAQVRDLEEKLETLRLKRAE DKAKLKELEKHKIQLEQVQEWKSKMQEQQADLQRRLKEARKEAKEALEAKERYMEEMADTADAIEMATLDKEMAEERAES LQQEVEALKERVDELTTDLEILKAEIEEKGSDGAASSYQLKQLEEQNARLKDALVRMRDLSSSEKQEHVKLQKLMEKKNQ ELEVVRQQRERLQEELSQAESTIDELKEQVDAALGAEEMVEMLTDRNLNLEEKVRELRETVGDLEAMNEMNDELQENARE TELELREQLDMAGARVREAQKRVEAAQETVADYQQTIKKYRQLTAHLQDVNRELTNQQEASVERQQQPPPETFDFKIKFA ETKAHAKAIEMELRQMEVAQANRHMSLLTAFMPDSFLRPGGDHDCVLVLLLMPRLICKAELIRKQAQEKFELSENCSERP GLRGAAGEQLSFAAGLVYSLSLLQATLHRYEHALSQCSVDVYKKVGSLYPEMSAHERSLDFLIELLHKDQLDETVNVEPL TKAIKYYQHLYSIHLAEQPEDCTMQLADHIKFTQSALDCMSVEVGRLRAFLQGGQEATDIALLLRDLETSCSDIRQFCKK IRRRMPGTDAPGIPAALAFGPQVSDTLLDCRKHLTWVVAVLQEVAAAAAQLIAPLAENEGLLVAALEELAFKASEQIYGT PSSSPYECLRQSCNILISTMNKLATAMQEGEYDAERPPSKPPPVELRAAALRAEITDAEGLGLKLEDRETVIKELKKSLK IKGEELSEANVRLSLLEKKLDSAAKDADERIEKVQTRLEETQALLRKKEKEFEETMDALQADIDQLEAEKAELKQRLNSQ SKRTIEGLRGPPPSGIATLVSGIAGEEQQRGAIPGQAPGSVPGPGLVKDSPLLLQQISAMRLHISQLQHENSILKGAQMK ASLASLPPLHVAKLSHEGPGSELPAGALYRKTSQLLETLNQLSTHTHVVDITRTSPAAKSPSAQLMEQVAQLKSLSDTVE KLKDEVLKETVSQRPGATVPTDFATFPSSAFLRAKEEQQDDTVYMGKVTFSCAAGFGQRHRLVLTQEQLHQLHSRLIS |
Structure Viewer (PDB: 2HL3) |
---|
Description |
||
---|---|---|
Cytoplasm {Experimental EvidencePubMed:17828277}. Cytoplasm, cytoskeleton {Experimental EvidencePubMed:17828277, Experimental EvidencePubMed:22777741, Experimental EvidencePubMed:25774020, Experimental EvidencePubMed:26972003}. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome {Experimental EvidencePubMed:14654843, Experimental EvidencePubMed:20719959, Experimental EvidencePubMed:23985322, Experimental EvidencePubMed:25774020}. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome, centriole {Experimental EvidencePubMed:23386061, Experimental EvidencePubMed:25774020}. Cytoplasm, cytoskeleton, spindle {Experimental EvidencePubMed:25774020}. Nucleus envelope {ECO:0000269|PubMed:20679239}. Cytoplasm, cell cortex {ECO:0000269|PubMed:22327364}. Note=Localizes to microtubule plus ends (PubMed:17828277, PubMed:22777741, PubMed:25774020). Localizes preferentially to the ends of tyrosinated microtubules (PubMed:26972003). Localization at centrosome is regulated by SLK- dependent phosphorylation (PubMed:23985322). Localizes to centrosome in a PARKDA-dependent manner (PubMed:20719959). Localizes to the subdistal appendage region of the centriole in a KIF3A-dependent manner (PubMed:23386061). PLK1-mediated phosphorylation at Ser-179 is essential for its localization in the nuclear envelope (PubMed:20679239). {Experimental EvidencePubMed:17828277, ECO:0000269|PubMed:20679239, Experimental EvidencePubMed:20719959, Experimental EvidencePubMed:22777741, Experimental EvidencePubMed:23386061, Experimental EvidencePubMed:23985322, Experimental EvidencePubMed:25774020, Experimental EvidencePubMed:26972003}. | Position in the Nuclear Envelope |
|
Location | Location ID | Description |
Nuclear Envelope | SL-0178 | The nuclear envelope is a membrane system which surrounds the nucleoplasm of eukaryotic cells. It is composed of the nuclear lamina, nuclear pore complexes and two nuclear membranes. The space between the two membranes is called the nuclear intermembrane space. | Membrane Topology |
Topology | Source | Annotation Type |
Unknown | UniProt | Sequence Analysis | Assigned Ontology terms |
Cellular Component | Axon (GO:0030424) Cell Cortex (GO:0005938) Cell Cortex Region (GO:0099738) Cell Leading Edge (GO:0031252) Centriolar Subdistal Appendage (GO:0120103) Centriole (GO:0005814) Centrosome (GO:0005813) Ciliary Basal Body (GO:0036064) Cytoplasm (GO:0005737) Cytosol (GO:0005829) Dynein Complex (GO:0030286) Intercellular Bridge (GO:0045171) Kinetochore (GO:0000776) Membrane (GO:0016020) Microtubule (GO:0005874) Microtubule Associated Complex (GO:0005875) Microtubule Cytoskeleton (GO:0015630) Microtubule Plus-End (GO:0035371) Mitotic Spindle (GO:0072686) Neuron Projection (GO:0043005) Neuronal Cell Body (GO:0043025) Nuclear Envelope (GO:0005635) Nucleus (GO:0005634) Spindle (GO:0005819) Spindle Pole (GO:0000922) |
Description |
|
---|---|
Plays a key role in dynein-mediated retrograde transport of vesicles and organelles along microtubules by recruiting and tethering dynein to microtubules. Binds to both dynein and microtubules providing a link between specific cargos, microtubules and dynein. Essential for targeting dynein to microtubule plus ends, recruiting dynein to membranous cargos and enhancing dynein processivity (the ability to move along a microtubule for a long distance without falling off the track). Can also act as a brake to slow the dynein motor during motility along the microtubule (PubMed:25185702). Can regulate microtubule stability by promoting microtubule formation, nucleation and polymerization and by inhibiting microtubule catastrophe in neurons. Inhibits microtubule catastrophe by binding both to microtubules and to tubulin, leading to enhanced microtubule stability along the axon (PubMed:23874158). Plays a role in metaphase spindle orientation (PubMed:22327364). Plays a role in centriole cohesion and subdistal appendage organization and function. Its recruitment to the centriole in a KIF3A-dependent manner is essential for the maintenance of centriole cohesion and the formation of subdistal appendage. Also required for microtubule anchoring at the mother centriole (PubMed:23386061). Plays a role in primary cilia formation (PubMed:25774020). {Experimental EvidencePubMed:22327364, Experimental EvidencePubMed:23386061, Experimental EvidencePubMed:23874158, Experimental EvidencePubMed:25185702, Experimental EvidencePubMed:25774020}. | Assigned Ontology terms |
Biological Process | Cell Division (GO:0051301) Centriole-Centriole Cohesion (GO:0010457) Cytoplasmic Microtubule Organization (GO:0031122) Establishment Of Mitotic Spindle Orientation (GO:0000132) Maintenance Of Synapse Structure (GO:0099558) Melanosome Transport (GO:0032402) Microtubule Anchoring At Centrosome (GO:0034454) Mitotic Cell Cycle (GO:0000278) Motor Behavior (GO:0061744) Nervous System Development (GO:0007399) Neuromuscular Junction Development (GO:0007528) Neuromuscular Process (GO:0050905) Neuron Cellular Homeostasis (GO:0070050) Neuron Projection Maintenance (GO:1990535) Non-Motile Cilium Assembly (GO:1905515) Nuclear Membrane Disassembly (GO:0051081) Nuclear Migration (GO:0007097) Positive Regulation Of Microtubule Nucleation (GO:0090063) Positive Regulation Of Microtubule Polymerization (GO:0031116) Positive Regulation Of Neuromuscular Junction Development (GO:1904398) Regulation Of Mitotic Spindle Organization (GO:0060236) Retrograde Transport, Endosome To Golgi (GO:0042147) Ventral Spinal Cord Development (GO:0021517) |
Molecular Function | Microtubule Binding (GO:0008017) Microtubule Plus-End Binding (GO:0051010) Protein Kinase Binding (GO:0019901) Tau Protein Binding (GO:0048156) Tubulin Binding (GO:0015631) |
Description |
|
---|---|
Neuronopathy, distal hereditary motor, 7B (HMN7B) [MIM:607641]: A neuromuscular disorder. Distal hereditary motor neuronopathies constitute a heterogeneous group of neuromuscular disorders caused by selective degeneration of motor neurons in the anterior horn of the spinal cord, without sensory deficit in the posterior horn. The overall clinical picture consists of a classical distal muscular atrophy syndrome in the legs without clinical sensory loss. The disease starts with weakness and wasting of distal muscles of the anterior tibial and peroneal compartments of the legs. Later on, weakness and atrophy may expand to the proximal muscles of the lower limbs and/or to the distal upper limbs. {Experimental EvidencePubMed:12627231, Experimental EvidencePubMed:16505168, Experimental EvidencePubMed:19136952, Experimental EvidencePubMed:19279216, Experimental EvidencePubMed:22777741}. Note=The disease is caused by variants affecting the gene represented in this entry. Amyotrophic lateral sclerosis (ALS) [MIM:105400]: A neurodegenerative disorder affecting upper motor neurons in the brain and lower motor neurons in the brain stem and spinal cord, resulting in fatal paralysis. Sensory abnormalities are absent. The pathologic hallmarks of the disease include pallor of the corticospinal tract due to loss of motor neurons, presence of ubiquitin-positive inclusions within surviving motor neurons, and deposition of pathologic aggregates. The etiology of amyotrophic lateral sclerosis is likely to be multifactorial, involving both genetic and environmental factors. The disease is inherited in 5-10% of the cases. {Experimental EvidencePubMed:15326253, Experimental EvidencePubMed:16240349}. Note=Disease susceptibility is associated with variants affecting the gene represented in this entry. Perry syndrome (PERRYS) [MIM:168605]: A neuropsychiatric disorder characterized by mental depression not responsive to antidepressant drugs or electroconvulsive therapy, sleep disturbances, exhaustion and marked weight loss. Parkinsonism develops later and respiratory failure occurred terminally. {Experimental EvidencePubMed:19136952, Experimental EvidencePubMed:23874158, Experimental EvidencePubMed:24676999, Experimental EvidencePubMed:24881494, Experimental EvidencePubMed:25185702, ECO:0000269|PubMed:26972003}. Note=The disease is caused by variants affecting the gene represented in this entry. | Database Associations |
OMIM | 105400 168605 601143 607641 |
DisGeNET | 1639 |
Interactions with Nuclear Envelope proteins (12 interactors) |
|||
---|---|---|---|
Partner (NucEnvDB) | IntAct | Confidence score | |
O00423 | Echinoderm microtubule-associated protein-like 1 | EBI-11366138 | 0.27 |
O08788 | Dynactin subunit 1 | EBI-2561198 | 0.56 |
O15027 | Protein transport protein Sec16A | EBI-11083608 | 0.35 |
P29991 | RNA-directed RNA polymerase NS5 | EBI-8829140 | 0.37 |
P43034 | Platelet-activating factor acetylhydrolase IB subunit beta | EBI-11382201 | 0.48 |
P58546 | Myotrophin | EBI-11382201 | 0.27 |
Q14244 | Ensconsin | EBI-11366138 | 0.27 |
Q92900 | Regulator of nonsense transcripts 1 | EBI-11382201 | 0.27 |
Q9H6S0 | 3'-5' RNA helicase YTHDC2 | EBI-11382201 | 0.27 |
Q9Y2M5 | Kelch-like protein 20 | EBI-25840739 | 0.56 |
Q6ZMQ8 | Serine/threonine-protein kinase LMTK1 | EBI-32723474 | 0.27 |
Q921C5 | Protein bicaudal D homolog 2 | EBI-7894652 | 0.35 | Interactions with other proteins (281 interactors) |
Partner (UniProt) | IntAct | Confidence score | |
Q9UBN7 | Histone deacetylase 6 (HD6) (EC 3.5.1.98) (Tubulin-lysine deacetylase HDAC6) (EC 3.5.1.-) | EBI-25840647 | 0.56 |
P42025 | Beta-centractin (Actin-related protein 1B) (ARP1B) | EBI-367597 | 0.54 |
Q96KM6 | Zinc finger protein 512B | EBI-7216721 | 0.37 |
P18669 | Phosphoglycerate mutase 1 (EC 5.4.2.11) (EC 5.4.2.4) (BPG-dependent PGAM 1) (Phosphoglycerate mutase isozyme B) (PGAM-B) | EBI-736541 | 0.00 |
P30622 | CAP-Gly domain-containing linker protein 1 (Cytoplasmic linker protein 1) (Cytoplasmic linker protein 170 alpha-2) (CLIP-170) (Reed-Sternberg intermediate filament-associated protein) (Restin) | EBI-15657003 | 0.76 |
P20340 | Ras-related protein Rab-6A (Rab-6) | EBI-8604645 | 0.40 |
P49662 | Caspase-4 (CASP-4) (EC 3.4.22.57) (ICE and Ced-3 homolog 2) (ICH-2) (ICE(rel)-II) (Mih1) (Protease TX) [Cleaved into: Caspase-4 subunit p10; Caspase-4 subunit p20] | EBI-1063339 | 0.00 |
P43360 | Melanoma-associated antigen 6 (Cancer/testis antigen 1.6) (CT1.6) (MAGE-6 antigen) (MAGE3B antigen) | EBI-25840462 | 0.56 |
Q9H8T0 | AKT-interacting protein (Ft1) (Fused toes protein homolog) | EBI-1070932 | 0.00 |
P01106 | Myc proto-oncogene protein (Class E basic helix-loop-helix protein 39) (bHLHe39) (Proto-oncogene c-Myc) (Transcription factor p64) | EBI-1072184 | 0.00 |
P62330 | ADP-ribosylation factor 6 (EC 3.6.5.2) | EBI-1073142 | 0.00 |
P40337 | von Hippel-Lindau disease tumor suppressor (Protein G7) (pVHL) | EBI-1073742 | 0.00 |
O14593 | DNA-binding protein RFXANK (Ankyrin repeat family A protein 1) (Regulatory factor X subunit B) (RFX-B) (Regulatory factor X-associated ankyrin-containing protein) | EBI-1079448 | 0.00 |
Q9Y2Q3 | Glutathione S-transferase kappa 1 (EC 2.5.1.18) (GST 13-13) (GST class-kappa) (GSTK1-1) (hGSTK1) (Glutathione S-transferase subunit 13) | EBI-1080223 | 0.00 |
Q7L1Q6 | eIF5-mimic protein 2 (Basic leucine zipper and W2 domain-containing protein 1) (Protein Orf) | EBI-1082566 | 0.00 |
O76071 | Probable cytosolic iron-sulfur protein assembly protein CIAO1 (WD repeat-containing protein 39) | EBI-1083392 | 0.00 |
Q9NRI5 | Disrupted in schizophrenia 1 protein | EBI-1105616 | 0.00 |
Q96G01 | Protein bicaudal D homolog 1 (Bic-D 1) | EBI-7141949 | 0.43 |
P10636 | Microtubule-associated protein tau (Neurofibrillary tangle protein) (Paired helical filament-tau) (PHF-tau) | EBI-7637855 | 0.70 |
Q8NFJ9 | Bardet-Biedl syndrome 1 protein (BBS2-like protein 2) | EBI-25840415 | 0.56 |
Q96RK4 | Bardet-Biedl syndrome 4 protein | EBI-1805881 | 0.63 |
P54256 | Huntingtin-associated protein 1 (HAP-1) | EBI-8013384 | 0.65 |
P61164 | Alpha-centractin (Centractin) (ARP1) (Actin-RPV) (Centrosome-associated actin homolog) | EBI-2559425 | 0.40 |
Q99KJ8 | Dynactin subunit 2 (50 kDa dynein-associated polypeptide) (Dynactin complex 50 kDa subunit) (DCTN-50) (Growth cone membrane protein 23-48K) (GMP23-48K) (p50 dynamitin) | EBI-2559460 | 0.56 |
Q9Z0Y1 | Dynactin subunit 3 (Dynactin light chain p24) | EBI-2560063 | 0.56 |
P47753 | F-actin-capping protein subunit alpha-1 (CapZ alpha-1) | EBI-2563793 | 0.40 |
Q0VEJ0 | Centrosomal protein of 76 kDa (Cep76) | EBI-2563897 | 0.40 |
Q99551 | Transcription termination factor 1, mitochondrial (Mitochondrial transcription termination factor 1) (mTERF) (mTERF1) | EBI-2690077 | 0.00 |
A0JNT9 | BICD family-like cargo adapter 1 (Bicaudal D-related protein 1) (BICD-related protein 1) (BICDR-1) (Coiled-coil domain-containing protein 64A) | EBI-7894392 | 0.43 |
Q13573 | SNW domain-containing protein 1 (Nuclear protein SkiP) (Nuclear receptor coactivator NCoA-62) (Ski-interacting protein) | EBI-7950968 | 0.35 |
Q9JK25 | CAP-Gly domain-containing linker protein 1 (Cytoplasmic linker protein 170) (CLIP-170) (Restin) | EBI-8098108 | 0.46 |
O14777 | Kinetochore protein NDC80 homolog (Highly expressed in cancer protein) (Kinetochore protein Hec1) (HsHec1) (Kinetochore-associated protein 2) (Retinoblastoma-associated protein HEC) | EBI-8098382 | 0.45 |
P42224 | Signal transducer and activator of transcription 1-alpha/beta (Transcription factor ISGF-3 components p91/p84) | EBI-3451713 | 0.00 |
Q8TCX1 | Cytoplasmic dynein 2 light intermediate chain 1 (Dynein 2 light intermediate chain) | EBI-8568044 | 0.46 |
O95817 | BAG family molecular chaperone regulator 3 (BAG-3) (Bcl-2-associated athanogene 3) (Bcl-2-binding protein Bis) (Docking protein CAIR-1) | EBI-8568339 | 0.35 |
P31749 | RAC-alpha serine/threonine-protein kinase (EC 2.7.11.1) (Protein kinase B) (PKB) (Protein kinase B alpha) (PKB alpha) (Proto-oncogene c-Akt) (RAC-PK-alpha) | EBI-7094924 | 0.37 |
Q16543 | Hsp90 co-chaperone Cdc37 (Hsp90 chaperone protein kinase-targeting subunit) (p50Cdc37) [Cleaved into: Hsp90 co-chaperone Cdc37, N-terminally processed] | EBI-7112856 | 0.37 |
Q6ZU52 | Uncharacterized protein KIAA0408 | EBI-7140179 | 0.37 |
O14576 | Cytoplasmic dynein 1 intermediate chain 1 (Cytoplasmic dynein intermediate chain 1) (Dynein intermediate chain 1, cytosolic) (DH IC-1) | EBI-25840452 | 0.56 |
P51955 | Serine/threonine-protein kinase Nek2 (EC 2.7.11.1) (HSPK 21) (Never in mitosis A-related kinase 2) (NimA-related protein kinase 2) (NimA-like protein kinase 1) | EBI-7257818 | 0.37 |
O60925 | Prefoldin subunit 1 | EBI-7284860 | 0.37 |
P13929 | Beta-enolase (EC 4.2.1.11) (2-phospho-D-glycerate hydro-lyase) (Enolase 3) (Muscle-specific enolase) (MSE) (Skeletal muscle enolase) | EBI-5658334 | 0.00 |
Q96S44 | EKC/KEOPS complex subunit TP53RK (EC 3.6.-.-) (Atypical serine/threonine protein kinase TP53RK) (Nori-2) (TP53-regulating kinase) (EC 2.7.11.1) (p53-related protein kinase) | EBI-5665262 | 0.00 |
P62136 | Serine/threonine-protein phosphatase PP1-alpha catalytic subunit (PP-1A) (EC 3.1.3.16) | EBI-5564400 | 0.37 |
O75381 | Peroxisomal membrane protein PEX14 (PTS1 receptor-docking protein) (Peroxin-14) (Peroxisomal membrane anchor protein PEX14) | EBI-5911953 | 0.35 |
P10209 | Capsid vertex component 2 | EBI-6509331 | 0.37 |
Q13618 | Cullin-3 (CUL-3) | EBI-21329068 | 0.35 |
Q9Y496 | Kinesin-like protein KIF3A (Microtubule plus end-directed kinesin motor 3A) | EBI-8847255 | 0.27 |
P28741 | Kinesin-like protein KIF3A (Microtubule plus end-directed kinesin motor 3A) | EBI-8847318 | 0.40 |
P88996 | 59 protein (DNA polymerase processivity subunit) (DNA replication protein) | EBI-9641406 | 0.37 |
O41964 | Tegument protein | EBI-9641478 | 0.37 |
Q14980 | Nuclear mitotic apparatus protein 1 (Nuclear matrix protein-22) (NMP-22) (Nuclear mitotic apparatus protein) (NuMA protein) (SP-H antigen) | EBI-10039064 | 0.27 |
Q14653 | Interferon regulatory factor 3 (IRF-3) | EBI-11321946 | 0.35 |
P05412 | Transcription factor Jun (Activator protein 1) (AP1) (Proto-oncogene c-Jun) (Transcription factor AP-1 subunit Jun) (V-jun avian sarcoma virus 17 oncogene homolog) (p39) | EBI-11324725 | 0.35 |
E9QKK1 | Centromere-associated protein E | EBI-10995761 | 0.35 |
Q8R1Q8 | Cytoplasmic dynein 1 light intermediate chain 1 (Dynein light chain A) (DLC-A) (Dynein light intermediate chain 1, cytosolic) | EBI-11000601 | 0.35 |
Q8VC57 | BTB/POZ domain-containing protein KCTD5 | EBI-11027413 | 0.35 |
Q96H55 | Unconventional myosin-XIX (Myosin head domain-containing protein 1) | EBI-11031416 | 0.35 |
P62627 | Dynein light chain roadblock-type 1 (Dynein light chain 2A, cytoplasmic) | EBI-11032607 | 0.35 |
Q9WUM4 | Coronin-1C (Coronin-3) | EBI-11065690 | 0.35 |
Q8R5C5 | Beta-centractin (Actin-related protein 1B) (ARP1B) | EBI-11073047 | 0.35 |
Q8CBY8 | Dynactin subunit 4 (Dynactin subunit p62) | EBI-11074062 | 0.35 |
Q9QZB9 | Dynactin subunit 5 (Dynactin subunit p25) | EBI-11074142 | 0.35 |
Q15691 | Microtubule-associated protein RP/EB family member 1 (APC-binding protein EB1) (End-binding protein 1) (EB1) | EBI-11091481 | 0.86 |
Q9WTI7 | Unconventional myosin-Ic (Myosin I beta) (MMI-beta) (MMIb) | EBI-11093786 | 0.35 |
P47755 | F-actin-capping protein subunit alpha-2 (CapZ alpha-2) | EBI-11117728 | 0.48 |
Q14134 | Tripartite motif-containing protein 29 (Ataxia telangiectasia group D-associated protein) | EBI-11137164 | 0.35 |
Q14204 | Cytoplasmic dynein 1 heavy chain 1 (Cytoplasmic dynein heavy chain 1) (Dynein heavy chain, cytosolic) | EBI-11148090 | 0.48 |
P14635 | G2/mitotic-specific cyclin-B1 | EBI-11366138 | 0.27 |
Q96T17 | MAP7 domain-containing protein 2 | EBI-11366138 | 0.27 |
Q9BT25 | HAUS augmin-like complex subunit 8 (HEC1/NDC80-interacting centrosome-associated protein 1) (Sarcoma antigen NY-SAR-48) | EBI-11366138 | 0.27 |
P31930 | Cytochrome b-c1 complex subunit 1, mitochondrial (Complex III subunit 1) (Core protein I) (Ubiquinol-cytochrome-c reductase complex core protein 1) | EBI-11366138 | 0.27 |
Q3KQU3 | MAP7 domain-containing protein 1 (Arginine/proline-rich coiled-coil domain-containing protein 1) (Proline/arginine-rich coiled-coil domain-containing protein 1) | EBI-11366138 | 0.27 |
O00139 | Kinesin-like protein KIF2A (Kinesin-2) (hK2) | EBI-11366138 | 0.27 |
Q9P0I2 | ER membrane protein complex subunit 3 (Transmembrane protein 111) | EBI-11366138 | 0.27 |
Q9NQ86 | E3 ubiquitin-protein ligase TRIM36 (EC 2.3.2.27) (RING finger protein 98) (RING-type E3 ubiquitin transferase TRIM36) (Tripartite motif-containing protein 36) (Zinc-binding protein Rbcc728) | EBI-11366138 | 0.27 |
P36776 | Lon protease homolog, mitochondrial (EC 3.4.21.53) (LONHs) (Lon protease-like protein) (LONP) (Mitochondrial ATP-dependent protease Lon) (Serine protease 15) | EBI-11366138 | 0.27 |
Q99643 | Succinate dehydrogenase cytochrome b560 subunit, mitochondrial (Integral membrane protein CII-3) (QPs-1) (QPs1) (Succinate dehydrogenase complex subunit C) (Succinate-ubiquinone oxidoreductase cytochrome B large subunit) (CYBL) | EBI-11366138 | 0.27 |
Q96GD4 | Aurora kinase B (EC 2.7.11.1) (Aurora 1) (Aurora- and IPL1-like midbody-associated protein 1) (AIM-1) (Aurora/IPL1-related kinase 2) (ARK-2) (Aurora-related kinase 2) (STK-1) (Serine/threonine-protein kinase 12) (Serine/threonine-protein kinase 5) (Serine/threonine-protein kinase aurora-B) | EBI-11366138 | 0.27 |
Q9HAU0 | Pleckstrin homology domain-containing family A member 5 (PH domain-containing family A member 5) (Phosphoinositol 3-phosphate-binding protein 2) (PEPP-2) | EBI-11366138 | 0.27 |
P61019 | Ras-related protein Rab-2A (EC 3.6.5.2) | EBI-11366138 | 0.27 |
Q08AD1 | Calmodulin-regulated spectrin-associated protein 2 (Calmodulin-regulated spectrin-associated protein 1-like protein 1) | EBI-11366138 | 0.27 |
Q96R06 | Sperm-associated antigen 5 (Astrin) (Deepest) (Mitotic spindle-associated protein p126) (MAP126) | EBI-11366138 | 0.27 |
Q01130 | Serine/arginine-rich splicing factor 2 (Protein PR264) (Splicing component, 35 kDa) (Splicing factor SC35) (SC-35) (Splicing factor, arginine/serine-rich 2) | EBI-11366138 | 0.27 |
Q96P70 | Importin-9 (Imp9) (Ran-binding protein 9) (RanBP9) | EBI-11366138 | 0.27 |
Q9Y5Y2 | Cytosolic Fe-S cluster assembly factor NUBP2 (Nucleotide-binding protein 2) (NBP 2) | EBI-11366138 | 0.27 |
Q15555 | Microtubule-associated protein RP/EB family member 2 (APC-binding protein EB2) (End-binding protein 2) (EB2) | EBI-11366138 | 0.27 |
Q8WWK9 | Cytoskeleton-associated protein 2 (CTCL tumor antigen se20-10) (Tumor- and microtubule-associated protein) | EBI-11366138 | 0.27 |
O75330 | Hyaluronan mediated motility receptor (Intracellular hyaluronic acid-binding protein) (Receptor for hyaluronan-mediated motility) (CD antigen CD168) | EBI-11366138 | 0.27 |
Q9BRR8 | G patch domain-containing protein 1 (Evolutionarily conserved G-patch domain-containing protein) | EBI-11366138 | 0.27 |
Q8WVK7 | Spindle and kinetochore-associated protein 2 (Protein FAM33A) | EBI-11366138 | 0.27 |
Q9NZ32 | Actin-related protein 10 (Actin-related protein 11) (hARP11) | EBI-11366138 | 0.62 |
P11137 | Microtubule-associated protein 2 (MAP-2) | EBI-11366138 | 0.27 |
Q8IWC1 | MAP7 domain-containing protein 3 | EBI-11366138 | 0.27 |
Q9NYZ3 | G2 and S phase-expressed protein 1 (GTSE-1) (Protein B99 homolog) | EBI-11366138 | 0.27 |
Q7Z460 | CLIP-associating protein 1 (Cytoplasmic linker-associated protein 1) (Multiple asters homolog 1) (Protein Orbit homolog 1) (hOrbit1) | EBI-11366138 | 0.27 |
Q9UJW0 | Dynactin subunit 4 (Dyn4) (Dynactin subunit p62) | EBI-11366138 | 0.62 |
Q9UPY8 | Microtubule-associated protein RP/EB family member 3 (EB1 protein family member 3) (EBF3) (End-binding protein 3) (EB3) (RP3) | EBI-11366138 | 0.27 |
Q5SW79 | Centrosomal protein of 170 kDa (Cep170) (KARP-1-binding protein) (KARP1-binding protein) | EBI-11366138 | 0.27 |
O00487 | 26S proteasome non-ATPase regulatory subunit 14 (EC 3.4.19.-) (26S proteasome regulatory subunit RPN11) (26S proteasome-associated PAD1 homolog 1) | EBI-11366138 | 0.27 |
Q8WU90 | Zinc finger CCCH domain-containing protein 15 (DRG family-regulatory protein 1) (Likely ortholog of mouse immediate early response erythropoietin 4) | EBI-11366138 | 0.27 |
Q969S3 | Cytoplasmic 60S subunit biogenesis factor ZNF622 (Zinc finger protein 622) (Zinc finger-like protein 9) | EBI-11366138 | 0.27 |
Q14847 | LIM and SH3 domain protein 1 (LASP-1) (Metastatic lymph node gene 50 protein) (MLN 50) | EBI-11366138 | 0.27 |
P43897 | Elongation factor Ts, mitochondrial (EF-Ts) (EF-TsMt) | EBI-11366138 | 0.27 |
Q9Y4F5 | Centrosomal protein of 170 kDa protein B (Centrosomal protein 170B) (Cep170B) | EBI-11366138 | 0.27 |
P50570 | Dynamin-2 (EC 3.6.5.5) | EBI-11366138 | 0.27 |
Q9ULD2 | Microtubule-associated tumor suppressor 1 (AT2 receptor-binding protein) (Angiotensin-II type 2 receptor-interacting protein) (Mitochondrial tumor suppressor 1) | EBI-11366138 | 0.27 |
O95373 | Importin-7 (Imp7) (Ran-binding protein 7) (RanBP7) | EBI-11366138 | 0.27 |
Q8N2U0 | Transmembrane protein 256 | EBI-11366138 | 0.27 |
Q8IX90 | Spindle and kinetochore-associated protein 3 | EBI-11366138 | 0.27 |
O15075 | Serine/threonine-protein kinase DCLK1 (EC 2.7.11.1) (Doublecortin domain-containing protein 3A) (Doublecortin-like and CAM kinase-like 1) (Doublecortin-like kinase 1) | EBI-11366138 | 0.27 |
Q15286 | Ras-related protein Rab-35 (GTP-binding protein RAY) (Ras-related protein Rab-1C) | EBI-11366138 | 0.27 |
P51665 | 26S proteasome non-ATPase regulatory subunit 7 (26S proteasome regulatory subunit RPN8) (26S proteasome regulatory subunit S12) (Mov34 protein homolog) (Proteasome subunit p40) | EBI-11366138 | 0.27 |
Q53H12 | Acylglycerol kinase, mitochondrial (hAGK) (EC 2.7.1.107) (EC 2.7.1.138) (EC 2.7.1.94) (Multiple substrate lipid kinase) (HsMuLK) (MuLK) (Multi-substrate lipid kinase) | EBI-11366138 | 0.27 |
Q9H3G5 | Probable serine carboxypeptidase CPVL (EC 3.4.16.-) (Carboxypeptidase, vitellogenic-like) (Vitellogenic carboxypeptidase-like protein) (VCP-like protein) (hVLP) | EBI-11366138 | 0.27 |
Q99733 | Nucleosome assembly protein 1-like 4 (Nucleosome assembly protein 2) (NAP-2) | EBI-11366138 | 0.27 |
Q86V48 | Leucine zipper protein 1 | EBI-11366138 | 0.27 |
P61163 | Alpha-centractin (Centractin) (ARP1) (Actin-RPV) (Centrosome-associated actin homolog) | EBI-11366138 | 0.62 |
Q96K17 | Transcription factor BTF3 homolog 4 (Basic transcription factor 3-like 4) | EBI-11366138 | 0.27 |
Q9HC35 | Echinoderm microtubule-associated protein-like 4 (EMAP-4) (Restrictedly overexpressed proliferation-associated protein) (Ropp 120) | EBI-11366138 | 0.27 |
O00399 | Dynactin subunit 6 (Dynactin subunit p27) (Protein WS-3) | EBI-11366138 | 0.62 |
Q9Y4L1 | Hypoxia up-regulated protein 1 (150 kDa oxygen-regulated protein) (ORP-150) (170 kDa glucose-regulated protein) (GRP-170) | EBI-11366138 | 0.27 |
Q49MG5 | Microtubule-associated protein 9 (Aster-associated protein) | EBI-11366138 | 0.27 |
Q00610 | Clathrin heavy chain 1 (Clathrin heavy chain on chromosome 17) (CLH-17) | EBI-11366138 | 0.27 |
Q8IYA6 | Cytoskeleton-associated protein 2-like (Radial fiber and mitotic spindle protein) (Radmis) | EBI-11366138 | 0.27 |
Q9GZQ8 | Microtubule-associated proteins 1A/1B light chain 3B (Autophagy-related protein LC3 B) (Autophagy-related ubiquitin-like modifier LC3 B) (MAP1 light chain 3-like protein 2) (MAP1A/MAP1B light chain 3 B) (MAP1A/MAP1B LC3 B) (Microtubule-associated protein 1 light chain 3 beta) | EBI-11366138 | 0.27 |
Q99848 | Probable rRNA-processing protein EBP2 (EBNA1-binding protein 2) (Nucleolar protein p40) | EBI-11366138 | 0.27 |
Q66K74 | Microtubule-associated protein 1S (MAP-1S) (BPY2-interacting protein 1) (Microtubule-associated protein 8) (Variable charge Y chromosome 2-interacting protein 1) (VCY2-interacting protein 1) (VCY2IP-1) [Cleaved into: MAP1S heavy chain; MAP1S light chain] | EBI-11366138 | 0.27 |
P20290 | Transcription factor BTF3 (Nascent polypeptide-associated complex subunit beta) (NAC-beta) (RNA polymerase B transcription factor 3) | EBI-11366138 | 0.27 |
Q13561 | Dynactin subunit 2 (50 kDa dynein-associated polypeptide) (Dynactin complex 50 kDa subunit) (DCTN-50) (p50 dynamitin) | EBI-11366138 | 0.62 |
O75935 | Dynactin subunit 3 (Dynactin complex subunit 22 kDa subunit) (p22) | EBI-11366138 | 0.62 |
P61006 | Ras-related protein Rab-8A (EC 3.6.5.2) (Oncogene c-mel) | EBI-11366138 | 0.27 |
Q13423 | NAD(P) transhydrogenase, mitochondrial (EC 7.1.1.1) (Nicotinamide nucleotide transhydrogenase) (Pyridine nucleotide transhydrogenase) | EBI-11366138 | 0.27 |
Q9Y6M1 | Insulin-like growth factor 2 mRNA-binding protein 2 (IGF2 mRNA-binding protein 2) (IMP-2) (Hepatocellular carcinoma autoantigen p62) (IGF-II mRNA-binding protein 2) (VICKZ family member 2) | EBI-11366138 | 0.27 |
O94905 | Erlin-2 (Endoplasmic reticulum lipid raft-associated protein 2) (Stomatin-prohibitin-flotillin-HflC/K domain-containing protein 2) (SPFH domain-containing protein 2) | EBI-11366138 | 0.27 |
P30419 | Glycylpeptide N-tetradecanoyltransferase 1 (EC 2.3.1.97) (Myristoyl-CoA:protein N-myristoyltransferase 1) (HsNMT1) (NMT 1) (Type I N-myristoyltransferase) (Peptide N-myristoyltransferase 1) (Protein-lysine myristoyltransferase NMT1) (EC 2.3.1.-) | EBI-11366138 | 0.27 |
P22570 | NADPH:adrenodoxin oxidoreductase, mitochondrial (AR) (Adrenodoxin reductase) (EC 1.18.1.6) (Ferredoxin--NADP(+) reductase) (Ferredoxin reductase) | EBI-11366138 | 0.27 |
P55209 | Nucleosome assembly protein 1-like 1 (NAP-1-related protein) (hNRP) | EBI-11366138 | 0.27 |
Q9Y448 | Small kinetochore-associated protein (SKAP) (Kinetochore-localized astrin-binding protein) (Kinastrin) (Kinetochore-localized astrin/SPAG5-binding protein) (TRAF4-associated factor 1) | EBI-11366138 | 0.27 |
Q5JU00 | Dynein regulatory complex subunit 5 (T-complex-associated testis-expressed protein 1) (Tcte-1) | EBI-11367780 | 0.27 |
Q8N4C6 | Ninein (hNinein) (Glycogen synthase kinase 3 beta-interacting protein) (GSK3B-interacting protein) | EBI-11374469 | 0.27 |
Q8NBT2 | Kinetochore protein Spc24 (hSpc24) | EBI-11382201 | 0.27 |
Q6P1N0 | Coiled-coil and C2 domain-containing protein 1A (Akt kinase-interacting protein 1) (Five prime repressor element under dual repression-binding protein 1) (FRE under dual repression-binding protein 1) (Freud-1) (Putative NF-kappa-B-activating protein 023N) | EBI-11382201 | 0.27 |
P07203 | Glutathione peroxidase 1 (GPx-1) (GSHPx-1) (EC 1.11.1.9) (Cellular glutathione peroxidase) | EBI-11382201 | 0.27 |
Q99661 | Kinesin-like protein KIF2C (Kinesin-like protein 6) (Mitotic centromere-associated kinesin) (MCAK) | EBI-11382201 | 0.27 |
Q9BXJ9 | N-alpha-acetyltransferase 15, NatA auxiliary subunit (Gastric cancer antigen Ga19) (N-terminal acetyltransferase) (NMDA receptor-regulated protein 1) (Protein tubedown-1) (Tbdn100) | EBI-11382201 | 0.27 |
Q9P1F3 | Costars family protein ABRACL (ABRA C-terminal-like protein) | EBI-11382201 | 0.27 |
Q5EBL8 | PDZ domain-containing protein 11 (ATPase-interacting PDZ protein) (Plasma membrane calcium ATPase-interacting single-PDZ protein) (PMCA-interacting single-PDZ protein) | EBI-11382201 | 0.27 |
Q9P289 | Serine/threonine-protein kinase 26 (EC 2.7.11.1) (MST3 and SOK1-related kinase) (Mammalian STE20-like protein kinase 4) (MST-4) (STE20-like kinase MST4) (Serine/threonine-protein kinase MASK) | EBI-11382201 | 0.27 |
Q9Y5B9 | FACT complex subunit SPT16 (Chromatin-specific transcription elongation factor 140 kDa subunit) (FACT 140 kDa subunit) (FACTp140) (Facilitates chromatin transcription complex subunit SPT16) (hSPT16) | EBI-11382201 | 0.27 |
Q96CT7 | Coiled-coil domain-containing protein 124 | EBI-11382201 | 0.27 |
Q7Z4H7 | HAUS augmin-like complex subunit 6 | EBI-11382201 | 0.27 |
Q9BX40 | Protein LSM14 homolog B (RNA-associated protein 55B) (hRAP55B) | EBI-11382201 | 0.27 |
Q13409 | Cytoplasmic dynein 1 intermediate chain 2 (Cytoplasmic dynein intermediate chain 2) (Dynein intermediate chain 2, cytosolic) (DH IC-2) | EBI-11382201 | 0.27 |
Q9Y5A9 | YTH domain-containing family protein 2 (DF2) (CLL-associated antigen KW-14) (High-glucose-regulated protein 8) (Renal carcinoma antigen NY-REN-2) | EBI-11382201 | 0.27 |
O76041 | Nebulette (Actin-binding Z-disk protein) | EBI-11382201 | 0.27 |
Q96GY0 | Zinc finger C2HC domain-containing protein 1A | EBI-11382201 | 0.27 |
P41227 | N-alpha-acetyltransferase 10 (EC 2.3.1.255) (N-terminal acetyltransferase complex ARD1 subunit homolog A) (hARD1) (NatA catalytic subunit Naa10) | EBI-11382201 | 0.27 |
Q7KZI7 | Serine/threonine-protein kinase MARK2 (EC 2.7.11.1) (EC 2.7.11.26) (ELKL motif kinase 1) (EMK-1) (MAP/microtubule affinity-regulating kinase 2) (PAR1 homolog) (PAR1 homolog b) (Par-1b) (Par1b) | EBI-11382201 | 0.27 |
Q9H6D7 | HAUS augmin-like complex subunit 4 | EBI-11382201 | 0.27 |
O75122 | CLIP-associating protein 2 (Cytoplasmic linker-associated protein 2) (Protein Orbit homolog 2) (hOrbit2) | EBI-11382201 | 0.27 |
O14640 | Segment polarity protein dishevelled homolog DVL-1 (Dishevelled-1) (DSH homolog 1) | EBI-11382201 | 0.27 |
Q8TAT6 | Nuclear protein localization protein 4 homolog (Protein NPL4) | EBI-11382201 | 0.27 |
P33981 | Dual specificity protein kinase TTK (EC 2.7.12.1) (Phosphotyrosine picked threonine-protein kinase) (PYT) | EBI-11382201 | 0.27 |
Q5QJ74 | Tubulin-specific chaperone cofactor E-like protein (EL) (Leucine-rich repeat-containing protein 35) | EBI-11382201 | 0.27 |
P04083 | Annexin A1 (Annexin I) (Annexin-1) (Calpactin II) (Calpactin-2) (Chromobindin-9) (Lipocortin I) (Phospholipase A2 inhibitory protein) (p35) [Cleaved into: Annexin Ac2-26] | EBI-11382201 | 0.27 |
Q9H4H8 | Protein FAM83D (Spindle protein CHICA) | EBI-11382201 | 0.27 |
O43663 | Protein regulator of cytokinesis 1 | EBI-11382201 | 0.27 |
Q2NL82 | Pre-rRNA-processing protein TSR1 homolog | EBI-11382201 | 0.27 |
Q8N568 | Serine/threonine-protein kinase DCLK2 (EC 2.7.11.1) (CaMK-like CREB regulatory kinase 2) (CL2) (CLICK-II) (CLICK2) (Doublecortin domain-containing protein 3B) (Doublecortin-like and CAM kinase-like 2) (Doublecortin-like kinase 2) | EBI-11382201 | 0.27 |
Q96BD8 | Spindle and kinetochore-associated protein 1 | EBI-11382201 | 0.27 |
Q9BYV8 | Centrosomal protein of 41 kDa (Cep41) (Testis-specific gene A14 protein) | EBI-11382201 | 0.27 |
Q9C0F1 | Centrosomal protein of 44 kDa (Cep44) (HBV PreS1-transactivated protein 3) (PS1TP3) | EBI-11382201 | 0.27 |
Q5T5Y3 | Calmodulin-regulated spectrin-associated protein 1 | EBI-11382201 | 0.27 |
Q16718 | NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 (Complex I subunit B13) (Complex I-13kD-B) (CI-13kD-B) (NADH-ubiquinone oxidoreductase 13 kDa-B subunit) | EBI-11382201 | 0.27 |
E9PAV3 | Nascent polypeptide-associated complex subunit alpha, muscle-specific form (Alpha-NAC, muscle-specific form) (skNAC) | EBI-11382201 | 0.27 |
Q9NX55 | Huntingtin-interacting protein K (Huntingtin yeast partner K) | EBI-11382201 | 0.27 |
Q9UHG0 | Doublecortin domain-containing protein 2 (Protein RU2S) | EBI-11382201 | 0.27 |
Q9UNY4 | Transcription termination factor 2 (EC 3.6.4.-) (Lodestar homolog) (RNA polymerase II termination factor) (Transcription release factor 2) (F2) (HuF2) | EBI-11382201 | 0.27 |
Q9H7E2 | Tudor domain-containing protein 3 | EBI-11382201 | 0.27 |
P49458 | Signal recognition particle 9 kDa protein (SRP9) | EBI-11382201 | 0.27 |
Q9BWT3 | Poly(A) polymerase gamma (PAP-gamma) (EC 2.7.7.19) (Neo-poly(A) polymerase) (Neo-PAP) (Polynucleotide adenylyltransferase gamma) (SRP RNA 3'-adenylating enzyme) (Signal recognition particle RNA-adenylating enzyme) (SRP RNA-adenylating enzyme) | EBI-11382201 | 0.27 |
Q9BYJ9 | YTH domain-containing family protein 1 (DF1) (Dermatomyositis associated with cancer putative autoantigen 1) (DACA-1) | EBI-11382201 | 0.27 |
Q15058 | Kinesin-like protein KIF14 | EBI-11382201 | 0.27 |
Q96GA3 | Protein LTV1 homolog | EBI-11382201 | 0.27 |
Q92974 | Rho guanine nucleotide exchange factor 2 (Guanine nucleotide exchange factor H1) (GEF-H1) (Microtubule-regulated Rho-GEF) (Proliferating cell nucleolar antigen p40) | EBI-11382201 | 0.27 |
Q15398 | Disks large-associated protein 5 (DAP-5) (Discs large homolog 7) (Disks large-associated protein DLG7) (Hepatoma up-regulated protein) (HURP) | EBI-11382201 | 0.27 |
Q8NHV4 | Protein NEDD1 (Neural precursor cell expressed developmentally down-regulated protein 1) (NEDD-1) | EBI-11382201 | 0.27 |
Q9Y3Y2 | Chromatin target of PRMT1 protein (Friend of PRMT1 protein) (Small arginine- and glycine-rich protein) (SRAG) | EBI-11382201 | 0.27 |
Q9P2B7 | Cilia- and flagella-associated protein 97 | EBI-11382201 | 0.27 |
Q99871 | HAUS augmin-like complex subunit 7 (26S proteasome-associated UCH37-interacting protein 1) (UCHL5-interacting protein) (X-linked protein STS1769) | EBI-11382201 | 0.27 |
Q9P270 | SLAIN motif-containing protein 2 | EBI-11382201 | 0.27 |
Q86XJ1 | GAS2-like protein 3 (Growth arrest-specific protein 2-like 3) | EBI-11382201 | 0.27 |
Q9BTE1 | Dynactin subunit 5 (Dynactin subunit p25) | EBI-21619572 | 0.35 |
H9XIJ5 | Polymerase basic protein 2 (RNA-directed RNA polymerase subunit P3) | EBI-11514215 | 0.37 |
P47756 | F-actin-capping protein subunit beta (CapZ beta) | EBI-12449631 | 0.51 |
P52907 | F-actin-capping protein subunit alpha-1 (CapZ alpha-1) | EBI-12449631 | 0.51 |
Q9Y2I6 | Ninein-like protein | EBI-12451292 | 0.35 |
G3G960 | VP1/2 | EBI-11688985 | 0.40 |
Q9UQM7 | Calcium/calmodulin-dependent protein kinase type II subunit alpha (CaM kinase II subunit alpha) (CaMK-II subunit alpha) (EC 2.7.11.17) | EBI-11913229 | 0.00 |
Q8N157 | Jouberin (Abelson helper integration site 1 protein homolog) (AHI-1) | EBI-11922091 | 0.00 |
Q16082 | Heat shock protein beta-2 (HspB2) (DMPK-binding protein) (MKBP) | EBI-15187599 | 0.37 |
P02511 | Alpha-crystallin B chain (Alpha(B)-crystallin) (Heat shock protein beta-5) (HspB5) (Renal carcinoma antigen NY-REN-27) (Rosenthal fiber component) | EBI-15187643 | 0.37 |
Q3KP66 | Innate immunity activator protein | EBI-21617875 | 0.35 |
Q99797 | Mitochondrial intermediate peptidase (MIP) (EC 3.4.24.59) | EBI-21619572 | 0.35 |
Q6XUX3 | Dual serine/threonine and tyrosine protein kinase (EC 2.7.12.1) (Dusty protein kinase) (Dusty PK) (RIP-homologous kinase) (Receptor-interacting serine/threonine-protein kinase 5) (Sugen kinase 496) (SgK496) | EBI-21619572 | 0.35 |
P62736 | Actin, aortic smooth muscle (EC 3.6.4.-) (Alpha-actin-2) (Cell growth-inhibiting gene 46 protein) [Cleaved into: Actin, aortic smooth muscle, intermediate form] | EBI-21619572 | 0.35 |
D6R9G5 | Kelch-like protein 2 | EBI-21619572 | 0.35 |
Q96MC5 | bMERB domain-containing protein 1 | EBI-21663233 | 0.35 |
Q86WX3 | Active regulator of SIRT1 (40S ribosomal protein S19-binding protein 1) (RPS19-binding protein 1) (S19BP) | EBI-21663135 | 0.35 |
Q9NPQ8 | Synembryn-A (Protein Ric-8A) | EBI-21663468 | 0.35 |
Q9GZP0 | Platelet-derived growth factor D (PDGF-D) (Iris-expressed growth factor) (Spinal cord-derived growth factor B) (SCDGF-B) [Cleaved into: Platelet-derived growth factor D, latent form (PDGFD latent form); Platelet-derived growth factor D, receptor-binding form (PDGFD receptor-binding form)] | EBI-21663347 | 0.35 |
Q13748 | Tubulin alpha-3C chain (EC 3.6.5.-) (Alpha-tubulin 2) (Alpha-tubulin 3C) (Tubulin alpha-2 chain) [Cleaved into: Detyrosinated tubulin alpha-3C chain] | EBI-15642149 | 0.44 |
Q9UNH7 | Sorting nexin-6 (TRAF4-associated factor 2) [Cleaved into: Sorting nexin-6, N-terminally processed] | EBI-16042701 | 0.50 |
O95219 | Sorting nexin-4 | EBI-16042750 | 0.35 |
Q08345 | Epithelial discoidin domain-containing receptor 1 (Epithelial discoidin domain receptor 1) (EC 2.7.10.1) (CD167 antigen-like family member A) (Cell adhesion kinase) (Discoidin receptor tyrosine kinase) (HGK2) (Mammary carcinoma kinase 10) (MCK-10) (Protein-tyrosine kinase 3A) (Protein-tyrosine kinase RTK-6) (TRK E) (Tyrosine kinase DDR) (Tyrosine-protein kinase CAK) (CD antigen CD167a) | EBI-22227061 | 0.35 |
A2A935 | Histone-lysine N-methyltransferase PRDM16 (EC 2.1.1.367) (PR domain zinc finger protein 16) (PR domain-containing protein 16) (Transcription factor MEL1) (MDS1/EVI1-like gene 1) | EBI-21024514 | 0.35 |
P14404 | Histone-lysine N-methyltransferase MECOM (EC 2.1.1.367) (Ecotropic virus integration site 1 protein) (EVI-1) (MDS1 and EVI1 complex locus protein) (Myelodysplasia syndrome 1 protein homolog) | EBI-21026252 | 0.35 |
Q5S007 | Leucine-rich repeat serine/threonine-protein kinase 2 (EC 2.7.11.1) (EC 3.6.5.-) (Dardarin) | EBI-21360986 | 0.35 |
Q9NQ75 | Cas scaffolding protein family member 4 (HEF-like protein) (HEF1-EFS-p130Cas-like protein) (HEPL) | EBI-21373041 | 0.00 |
Q9Y5K6 | CD2-associated protein (Adapter protein CMS) (Cas ligand with multiple SH3 domains) | EBI-21373015 | 0.00 |
Q9UKE5 | TRAF2 and NCK-interacting protein kinase (EC 2.7.11.1) | EBI-21373000 | 0.00 |
O84166 | Transmembrane protein | EBI-22302598 | 0.35 |
P0DOF2 | Matrix protein (Phosphoprotein M2) | EBI-25603126 | 0.35 |
P0DTC6 | ORF6 protein (ORF6) (Accessory protein 6) (Non-structural protein 6) (ns6) (Protein X3) | EBI-26495724 | 0.35 |
P18847 | Cyclic AMP-dependent transcription factor ATF-3 (cAMP-dependent transcription factor ATF-3) (Activating transcription factor 3) | EBI-25840405 | 0.56 |
O15392 | Baculoviral IAP repeat-containing protein 5 (Apoptosis inhibitor 4) (Apoptosis inhibitor survivin) | EBI-25840395 | 0.56 |
P63010 | AP-2 complex subunit beta (AP105B) (Adaptor protein complex AP-2 subunit beta) (Adaptor-related protein complex 2 subunit beta) (Beta-2-adaptin) (Beta-adaptin) (Clathrin assembly protein complex 2 beta large chain) (Plasma membrane adaptor HA2/AP2 adaptin beta subunit) | EBI-25840385 | 0.56 |
O60479 | Homeobox protein DLX-3 | EBI-25840435 | 0.56 |
P42574 | Caspase-3 (CASP-3) (EC 3.4.22.56) (Apopain) (Cysteine protease CPP32) (CPP-32) (Protein Yama) (SREBP cleavage activity 1) (SCA-1) [Cleaved into: Caspase-3 subunit p17; Caspase-3 subunit p12] | EBI-25840425 | 0.56 |
Q9ULX5 | RING finger protein 112 (EC 2.3.2.27) (Brain finger protein) (Zinc finger protein 179) | EBI-25840575 | 0.56 |
Q8WUW1 | Protein BRICK1 (BRK1) | EBI-25840565 | 0.56 |
P62987 | Ubiquitin-60S ribosomal protein L40 (CEP52) (Ubiquitin A-52 residue ribosomal protein fusion product 1) [Cleaved into: Ubiquitin; 60S ribosomal protein L40 (Large ribosomal subunit protein eL40)] | EBI-25840555 | 0.56 |
Q15554 | Telomeric repeat-binding factor 2 (TTAGGG repeat-binding factor 2) (Telomeric DNA-binding protein) | EBI-25840542 | 0.56 |
P19474 | E3 ubiquitin-protein ligase TRIM21 (EC 2.3.2.27) (52 kDa Ro protein) (52 kDa ribonucleoprotein autoantigen Ro/SS-A) (RING finger protein 81) (RING-type E3 ubiquitin transferase TRIM21) (Ro(SS-A)) (Sjoegren syndrome type A antigen) (SS-A) (Tripartite motif-containing protein 21) | EBI-25840525 | 0.56 |
Q92834 | X-linked retinitis pigmentosa GTPase regulator | EBI-25840515 | 0.56 |
P17980 | 26S proteasome regulatory subunit 6A (26S proteasome AAA-ATPase subunit RPT5) (Proteasome 26S subunit ATPase 3) (Proteasome subunit P50) (Tat-binding protein 1) (TBP-1) | EBI-25840505 | 0.56 |
Q9BR81 | Protocadherin gamma subfamily C, 3 (Protocadherin gamma-C3) | EBI-25840495 | 0.56 |
O15381 | Nuclear valosin-containing protein-like (NVLp) (Nuclear VCP-like protein) | EBI-25840483 | 0.56 |
Q6NXG1 | Epithelial splicing regulatory protein 1 (RNA-binding motif protein 35A) (RNA-binding protein 35A) | EBI-25840813 | 0.56 |
Q9H0E2 | Toll-interacting protein | EBI-25840803 | 0.56 |
P57075 | Ubiquitin-associated and SH3 domain-containing protein A (Cbl-interacting protein 4) (CLIP4) (Suppressor of T-cell receptor signaling 2) (STS-2) (T-cell ubiquitin ligand 1) (TULA-1) | EBI-25840793 | 0.56 |
Q96RL1 | BRCA1-A complex subunit RAP80 (Receptor-associated protein 80) (Retinoid X receptor-interacting protein 110) (Ubiquitin interaction motif-containing protein 1) | EBI-25840783 | 0.56 |
O95777 | U6 snRNA-associated Sm-like protein LSm8 | EBI-25840771 | 0.56 |
Q04323 | UBX domain-containing protein 1 (SAPK substrate protein 1) (UBA/UBX 33.3 kDa protein) | EBI-25840761 | 0.56 |
Q9UJ41 | Rab5 GDP/GTP exchange factor (RAP1) (Rabaptin-5-associated exchange factor for Rab5) (Rabex-5) | EBI-25840749 | 0.56 |
Q99932 | Sperm-associated antigen 8 (HSD-1) (Sperm membrane protein 1) (SMP-1) (Sperm membrane protein BS-84) | EBI-25840729 | 0.56 |
Q96EK5 | KIF-binding protein (KIF1-binding protein) (Kinesin family binding protein) | EBI-25840719 | 0.56 |
Q8N488 | RING1 and YY1-binding protein (Apoptin-associating protein 1) (APAP-1) (Death effector domain-associated factor) (DED-associated factor) (YY1 and E4TF1-associated factor 1) | EBI-25840708 | 0.56 |
O00308 | NEDD4-like E3 ubiquitin-protein ligase WWP2 (EC 2.3.2.26) (Atrophin-1-interacting protein 2) (AIP2) (HECT-type E3 ubiquitin transferase WWP2) (WW domain-containing protein 2) | EBI-25840688 | 0.56 |
Q15436 | Protein transport protein Sec23A (hSec23A) (SEC23-related protein A) | EBI-25840677 | 0.56 |
Q9BSL1 | Ubiquitin-associated domain-containing protein 1 (UBA domain-containing protein 1) (E3 ubiquitin-protein ligase subunit KPC2) (Glialblastoma cell differentiation-related protein 1) (Kip1 ubiquitination-promoting complex protein 2) | EBI-25840667 | 0.56 |
O75886 | Signal transducing adapter molecule 2 (STAM-2) (Hrs-binding protein) | EBI-25840657 | 0.56 |
Q6DN90 | IQ motif and SEC7 domain-containing protein 1 (ADP-ribosylation factors guanine nucleotide-exchange protein 100) (ADP-ribosylation factors guanine nucleotide-exchange protein 2) (Brefeldin-resistant Arf-GEF 2 protein) (BRAG2) | EBI-25840625 | 0.56 |
Q9UHY8 | Fasciculation and elongation protein zeta-2 (Zygin II) (Zygin-2) | EBI-25840615 | 0.56 |
O95671 | Probable bifunctional dTTP/UTP pyrophosphatase/methyltransferase protein [Includes: dTTP/UTP pyrophosphatase (dTTPase/UTPase) (EC 3.6.1.9) (Nucleoside triphosphate pyrophosphatase) (Nucleotide pyrophosphatase) (Nucleotide PPase); N-acetylserotonin O-methyltransferase-like protein (ASMTL) (EC 2.1.1.-)] | EBI-25840605 | 0.56 |
Q9UNS2 | COP9 signalosome complex subunit 3 (SGN3) (Signalosome subunit 3) (JAB1-containing signalosome subunit 3) | EBI-25840595 | 0.56 |
P46379 | Large proline-rich protein BAG6 (BAG family molecular chaperone regulator 6) (BCL2-associated athanogene 6) (BAG-6) (HLA-B-associated transcript 3) (Protein G3) (Protein Scythe) | EBI-25840585 | 0.56 |
Q6ZTN6 | Ankyrin repeat domain-containing protein 13D | EBI-25840998 | 0.56 |
Q8NBM4 | Ubiquitin-associated domain-containing protein 2 (UBA domain-containing protein 2) (Phosphoglycerate dehydrogenase-like protein 1) | EBI-25840983 | 0.56 |
Q8TC29 | Enkurin | EBI-25840966 | 0.56 |
Q8IYW5 | E3 ubiquitin-protein ligase RNF168 (hRNF168) (EC 2.3.2.27) (RING finger protein 168) (RING-type E3 ubiquitin transferase RNF168) | EBI-25840956 | 0.56 |
Q96D59 | E3 ubiquitin-protein ligase RNF183 (EC 2.3.2.27) | EBI-25840946 | 0.56 |
Q8WVJ9 | Twist-related protein 2 (Class A basic helix-loop-helix protein 39) (bHLHa39) (Dermis-expressed protein 1) (Dermo-1) | EBI-25840936 | 0.56 |
Q9BYZ2 | L-lactate dehydrogenase A-like 6B (EC 1.1.1.27) | EBI-25840926 | 0.56 |
Q8IY31 | Intraflagellar transport protein 20 homolog (hIFT20) | EBI-25840916 | 0.56 |
Q8N594 | MPN domain-containing protein (EC 3.4.-.-) | EBI-25840906 | 0.56 |
Q96JM7 | Lethal(3)malignant brain tumor-like protein 3 (H-l(3)mbt-like protein 3) (L(3)mbt-like protein 3) (L3mbt-like 3) (MBT-1) | EBI-25840896 | 0.56 |
Q9GZS3 | WD repeat-containing protein 61 (Meiotic recombination REC14 protein homolog) (SKI8 homolog) (Ski8) [Cleaved into: WD repeat-containing protein 61, N-terminally processed] | EBI-25840886 | 0.56 |
Q71RG4 | Transmembrane and ubiquitin-like domain-containing protein 2 | EBI-25840876 | 0.56 |
A4FUJ8 | MKL1 protein | EBI-25840866 | 0.56 |
Q9HCE7 | E3 ubiquitin-protein ligase SMURF1 (hSMURF1) (EC 2.3.2.26) (HECT-type E3 ubiquitin transferase SMURF1) (SMAD ubiquitination regulatory factor 1) (SMAD-specific E3 ubiquitin-protein ligase 1) | EBI-25840856 | 0.56 |
Q6GQQ9 | OTU domain-containing protein 7B (EC 3.4.19.12) (Cellular zinc finger anti-NF-kappa-B protein) (Cezanne) (Zinc finger A20 domain-containing protein 1) (Zinc finger protein Cezanne) | EBI-25840844 | 0.56 |
Q96FW1 | Ubiquitin thioesterase OTUB1 (EC 3.4.19.12) (Deubiquitinating enzyme OTUB1) (OTU domain-containing ubiquitin aldehyde-binding protein 1) (Otubain-1) (hOTU1) (Ubiquitin-specific-processing protease OTUB1) | EBI-25840833 | 0.56 |
Q9NV79 | Protein-L-isoaspartate O-methyltransferase domain-containing protein 2 | EBI-25840823 | 0.56 |
P05067 | Amyloid-beta precursor protein (APP) (ABPP) (APPI) (Alzheimer disease amyloid A4 protein homolog) (Alzheimer disease amyloid protein) (Amyloid precursor protein) (Amyloid-beta (A4) precursor protein) (Amyloid-beta A4 protein) (Cerebral vascular amyloid peptide) (CVAP) (PreA4) (Protease nexin-II) (PN-II) [Cleaved into: N-APP; Soluble APP-alpha (S-APP-alpha); Soluble APP-beta (S-APP-beta); C99 (Beta-secretase C-terminal fragment) (Beta-CTF); Amyloid-beta protein 42 (Abeta42) (Beta-APP42); Amyloid-beta protein 40 (Abeta40) (Beta-APP40); C83 (Alpha-secretase C-terminal fragment) (Alpha-CTF); P3(42); P3(40); C80; Gamma-secretase C-terminal fragment 59 (Amyloid intracellular domain 59) (AICD-59) (AID(59)) (Gamma-CTF(59)); Gamma-secretase C-terminal fragment 57 (Amyloid intracellular domain 57) (AICD-57) (AID(57)) (Gamma-CTF(57)); Gamma-secretase C-terminal fragment 50 (Amyloid intracellular domain 50) (AICD-50) (AID(50)) (Gamma-CTF(50)); C31] | EBI-25938504 | 0.56 |
P51114 | RNA-binding protein FXR1 (FMR1 autosomal homolog 1) (hFXR1p) | EBI-26510253 | 0.37 |
P49639 | Homeobox protein Hox-A1 (Homeobox protein Hox-1F) | EBI-26512419 | 0.37 |
P13569 | Cystic fibrosis transmembrane conductance regulator (CFTR) (ATP-binding cassette sub-family C member 7) (Channel conductance-controlling ATPase) (EC 5.6.1.6) (cAMP-dependent chloride channel) | EBI-27087549 | 0.35 |
Q12792 | Twinfilin-1 (Protein A6) (Protein tyrosine kinase 9) | EBI-28939213 | 0.35 |
Q8NCK7 | Monocarboxylate transporter 11 (MCT 11) (Solute carrier family 16 member 11) | EBI-27103180 | 0.35 |
Database | Links |
UNIPROT | Q14203 A8MY36 B4DM45 E9PFS5 E9PGE1 G5E9H4 O95296 Q6IQ37 Q9BRM9 Q9UIU1 Q9UIU2 |
PDB | 1TXQ 2COY 2HKN 2HKQ 2HL3 2HL5 2HQH 3E2U 3TQ7 |
Pfam | PF01302 PF12455 |
PROSITE | PS00845 PS50245 |
OMIM | 105400 168605 601143 607641 |
DisGeNET | 1639 |