Protein Information |
|
|---|---|
| Protein Name | Clathrin interactor 1 |
| Accession Code | Q14677 |
| Gene | CLINT1 |
| Organism | Homo sapiens | Human (Taxonomy: 9606) |
| Part of Reference Proteome? | Yes |
| Sequence (Length: 625) | |
|
MLNMWKVRELVDKATNVVMNYSEIESKVREATNDDPWGPSGQLMGEIAKATFMYEQFPELMNMLWSRMLKDNKKNWRRVY KSLLLLAYLIRNGSERVVTSAREHIYDLRSLENYHFVDEHGKDQGINIRQKVKELVEFAQDDDRLREERKKAKKNKDKYV GVSSDSVGGFRYSERYDPEPKSKWDEEWDKNKSAFPFSDKLGELSDKIGSTIDDTISKFRRKDREDSPERCSDSDEEKKA RRGRSPKGEFKDEEETVTTKHIHITQATETTTTRHKRTANPSKTIDLGAAAHYTGDKASPDQNASTHTPQSSVKTSVPSS KSSGDLVDLFDGTSQSTGGSADLFGGFADFGSAAASGSFPSQVTATSGNGDFGDWSAFNQAPSGPVASSGEFFGSASQPA VELVSGSQSALGPPPAASNSSDLFDLMGSSQATMTSSQSMNFSMMSTNTVGLGLPMSRSQNTDMVQKSVSKTLPSTWSDP SVNISLDNLLPGMQPSKPQQPSLNTMIQQQNMQQPMNVMTQSFGAVNLSSPSNMLPVRPQTNALIGGPMPMSMPNVMTGT MGMAPLGNTPMMNQSMMGMNMNIGMSAAGMGLTGTMGMGMPNIAMTSGTVQPKQDAFANFANFSK |
|
Structure Viewer (PDB: 2QY7) |
|---|
Description |
||
|---|---|---|
| Cytoplasm. Cytoplasm, perinuclear region. Membrane; Peripheral membrane protein. Cytoplasmic vesicle, clathrin- coated vesicle. Note=Found throughout the cell, with the exception of the cell surface. Concentrated in the perinuclear region and associated with clathrin-coated vesicles close to the trans-Golgi network. | Position in the Nuclear Envelope |
|
| Location | Location ID | Description |
| Perinuclear Region | SL-0198 | The perinuclear region is the cytoplasmic region just around the nucleus. | Membrane Topology |
| Topology | Source | Annotation Type |
| Peripheral | UniProt | Sequence Analysis | Assigned Ontology terms |
| Cellular Component | Clathrin Vesicle Coat (GO:0030125) Cytosol (GO:0005829) Endosome (GO:0005768) Golgi Apparatus (GO:0005794) Intracellular Membrane-Bounded Organelle (GO:0043231) Membrane (GO:0016020) Nucleoplasm (GO:0005654) Perinuclear Region Of Cytoplasm (GO:0048471) Plasma Membrane (GO:0005886) |
|
Description |
|
|---|---|
| Binds to membranes enriched in phosphatidylinositol 4,5- bisphosphate (PtdIns(4,5)P2). May have a role in transport via clathrin-coated vesicles from the trans-Golgi network to endosomes. Stimulates clathrin assembly. {Experimental EvidencePubMed:12429846, Experimental EvidencePubMed:12538641}. | Assigned Ontology terms |
| Biological Process | Endocytosis (GO:0006897) |
| Molecular Function | Cadherin Binding (GO:0045296) Clathrin Binding (GO:0030276) Phospholipid Binding (GO:0005543) |
Interactions with Nuclear Envelope proteins (4 interactors) |
|||
|---|---|---|---|
| Partner (NucEnvDB) | IntAct | Confidence score | |
| O14976 | Cyclin-G-associated kinase | EBI-11150908 | 0.35 |
| O15027 | Protein transport protein Sec16A | EBI-11083608 | 0.35 |
| Q8WTR4 | Glycerophosphodiester phosphodiesterase domain-containing protein 5 | EBI-16430940 | 0.56 |
| P22892 | AP-1 complex subunit gamma-1 | EBI-7071326 | 0.54 | Interactions with other proteins (126 interactors) |
| Partner (UniProt) | IntAct | Confidence score | |
| P13569 | Cystic fibrosis transmembrane conductance regulator (CFTR) (ATP-binding cassette sub-family C member 7) (Channel conductance-controlling ATPase) (EC 5.6.1.6) (cAMP-dependent chloride channel) | EBI-1171360 | 0.35 |
| Q68FD5 | Clathrin heavy chain 1 | EBI-7071372 | 0.40 |
| Q96FJ0 | AMSH-like protease (AMSH-LP) (EC 3.4.19.-) (STAM-binding protein-like 1) | EBI-2511015 | 0.40 |
| O95630 | STAM-binding protein (EC 3.4.19.-) (Associated molecule with the SH3 domain of STAM) (Endosome-associated ubiquitin isopeptidase) | EBI-2511053 | 0.40 |
| Q9BXB5 | Oxysterol-binding protein-related protein 10 (ORP-10) (OSBP-related protein 10) | EBI-2514827 | 0.40 |
| Q9JLQ0 | CD2-associated protein (Mesenchyme-to-epithelium transition protein with SH3 domains 1) (METS-1) | EBI-2563436 | 0.40 |
| A0A5P8YCG4 | Probable outer membrane efflux lipoprotein | EBI-2847836 | 0.00 |
| A0A5P8YJZ1 | Putative stringent starvation protein A | EBI-2870530 | 0.00 |
| Q8CKM1 | Calcium-binding protein | EBI-2870523 | 0.00 |
| Q8ZD27 | tRNA pseudouridine synthase A (EC 5.4.99.12) (tRNA pseudouridine(38-40) synthase) (tRNA pseudouridylate synthase I) (tRNA-uridine isomerase I) | EBI-2870516 | 0.00 |
| A0A5P8YBI5 | Glycerophosphoryl diester phosphodiesterase (EC 3.1.4.46) | EBI-2870542 | 0.00 |
| Q8ZDX4 | Vitamin B12 import system permease protein BtuC | EBI-2870549 | 0.00 |
| Q99459 | Cell division cycle 5-like protein (Cdc5-like protein) (Pombe cdc5-related protein) | EBI-7954144 | 0.35 |
| O95166 | Gamma-aminobutyric acid receptor-associated protein (GABA(A) receptor-associated protein) (MM46) | EBI-2946896 | 0.44 |
| Q9H0R8 | Gamma-aminobutyric acid receptor-associated protein-like 1 (Early estrogen-regulated protein) (GABA(A) receptor-associated protein-like 1) (Glandular epithelial cell protein 1) (GEC-1) | EBI-2947275 | 0.52 |
| P60520 | Gamma-aminobutyric acid receptor-associated protein-like 2 (GABA(A) receptor-associated protein-like 2) (Ganglioside expression factor 2) (GEF-2) (General protein transport factor p16) (Golgi-associated ATPase enhancer of 16 kDa) (GATE-16) (MAP1 light chain 3-related protein) | EBI-2947563 | 0.44 |
| Q9GZQ8 | Microtubule-associated proteins 1A/1B light chain 3B (Autophagy-related protein LC3 B) (Autophagy-related ubiquitin-like modifier LC3 B) (MAP1 light chain 3-like protein 2) (MAP1A/MAP1B light chain 3 B) (MAP1A/MAP1B LC3 B) (Microtubule-associated protein 1 light chain 3 beta) | EBI-2947914 | 0.52 |
| Q9BXW4 | Microtubule-associated proteins 1A/1B light chain 3C (Autophagy-related protein LC3 C) (Autophagy-related ubiquitin-like modifier LC3 C) (MAP1 light chain 3-like protein 3) (MAP1A/MAP1B light chain 3 C) (MAP1A/MAP1B LC3 C) (Microtubule-associated protein 1 light chain 3 gamma) | EBI-2948265 | 0.44 |
| Q9H492 | Microtubule-associated proteins 1A/1B light chain 3A (Autophagy-related protein LC3 A) (Autophagy-related ubiquitin-like modifier LC3 A) (MAP1 light chain 3-like protein 1) (MAP1A/MAP1B light chain 3 A) (MAP1A/MAP1B LC3 A) (Microtubule-associated protein 1 light chain 3 alpha) | EBI-3044058 | 0.35 |
| Q13618 | Cullin-3 (CUL-3) | EBI-21329068 | 0.35 |
| Q9NQW6 | Anillin | EBI-11009421 | 0.35 |
| Q91X51 | Golgi reassembly-stacking protein 1 (Golgi peripheral membrane protein p65) (Golgi reassembly-stacking protein of 65 kDa) (GRASP65) | EBI-11015786 | 0.35 |
| Q99JI4 | 26S proteasome non-ATPase regulatory subunit 6 (26S proteasome regulatory subunit RPN7) (26S proteasome regulatory subunit S10) (p42A) | EBI-11026623 | 0.35 |
| Q92734 | Protein TFG (TRK-fused gene protein) | EBI-11029015 | 0.35 |
| Q92614 | Unconventional myosin-XVIIIa (Molecule associated with JAK3 N-terminus) (MAJN) (Myosin containing a PDZ domain) (Surfactant protein receptor SP-R210) (SP-R210) | EBI-11030093 | 0.35 |
| Q96H55 | Unconventional myosin-XIX (Myosin head domain-containing protein 1) | EBI-11031416 | 0.35 |
| O75787 | Renin receptor (ATPase H(+)-transporting lysosomal accessory protein 2) (ATPase H(+)-transporting lysosomal-interacting protein 2) (ER-localized type I transmembrane adapter) (Embryonic liver differentiation factor 10) (N14F) (Renin/prorenin receptor) (Vacuolar ATP synthase membrane sector-associated protein M8-9) (ATP6M8-9) (V-ATPase M8.9 subunit) [Cleaved into: Renin receptor N-terminal fragment; Renin receptor C-terminal fragment] | EBI-11037152 | 0.35 |
| P56377 | AP-1 complex subunit sigma-2 (Adaptor protein complex AP-1 subunit sigma-1B) (Adaptor-related protein complex 1 subunit sigma-1B) (Clathrin assembly protein complex 1 sigma-1B small chain) (Golgi adaptor HA1/AP1 adaptin sigma-1B subunit) (Sigma 1B subunit of AP-1 clathrin) (Sigma-adaptin 1B) (Sigma1B-adaptin) | EBI-11037753 | 0.35 |
| P21333 | Filamin-A (FLN-A) (Actin-binding protein 280) (ABP-280) (Alpha-filamin) (Endothelial actin-binding protein) (Filamin-1) (Non-muscle filamin) | EBI-11038784 | 0.35 |
| Q61879 | Myosin-10 (Cellular myosin heavy chain, type B) (Myosin heavy chain 10) (Myosin heavy chain, non-muscle IIb) (Non-muscle myosin heavy chain B) (NMMHC-B) (Non-muscle myosin heavy chain IIb) (NMMHC II-b) (NMMHC-IIB) | EBI-11041929 | 0.35 |
| P60710 | Actin, cytoplasmic 1 (Beta-actin) (EC 3.6.4.-) [Cleaved into: Actin, cytoplasmic 1, N-terminally processed] | EBI-11045267 | 0.35 |
| P51148 | Ras-related protein Rab-5C (EC 3.6.5.2) (L1880) (RAB5L) | EBI-11046231 | 0.35 |
| P63167 | Dynein light chain 1, cytoplasmic (8 kDa dynein light chain) (DLC8) (Dynein light chain LC8-type 1) (Protein inhibitor of neuronal nitric oxide synthase) (PIN) | EBI-12449761 | 0.51 |
| Q91YN9 | BAG family molecular chaperone regulator 2 (BAG-2) (Bcl-2-associated athanogene 2) | EBI-11052510 | 0.35 |
| Q9UHB6 | LIM domain and actin-binding protein 1 (Epithelial protein lost in neoplasm) | EBI-11058729 | 0.35 |
| Q9D6P8 | Calmodulin-like protein 3 | EBI-11062262 | 0.35 |
| G3X972 | Sec24-related gene family, member C (S. cerevisiae) | EBI-11079358 | 0.35 |
| Q91VZ6 | Stromal membrane-associated protein 1 | EBI-11079957 | 0.35 |
| Q16643 | Drebrin (Developmentally-regulated brain protein) | EBI-11080402 | 0.35 |
| P09497 | Clathrin light chain B (Lcb) | EBI-11081190 | 0.35 |
| Q9NYZ3 | G2 and S phase-expressed protein 1 (GTSE-1) (Protein B99 homolog) | EBI-11081743 | 0.35 |
| Q13492 | Phosphatidylinositol-binding clathrin assembly protein (Clathrin assembly lymphoid myeloid leukemia protein) | EBI-11082344 | 0.35 |
| Q00610 | Clathrin heavy chain 1 (Clathrin heavy chain on chromosome 17) (CLH-17) | EBI-11082478 | 0.35 |
| Q8N3V7 | Synaptopodin | EBI-11086992 | 0.35 |
| P13541 | Myosin-3 (Myosin heavy chain 3) | EBI-11092646 | 0.35 |
| Q8VDD5 | Myosin-9 (Cellular myosin heavy chain, type A) (Myosin heavy chain 9) (Myosin heavy chain, non-muscle IIa) (Non-muscle myosin heavy chain A) (NMMHC-A) (Non-muscle myosin heavy chain IIa) (NMMHC II-a) (NMMHC-IIA) | EBI-11092730 | 0.35 |
| Q9WTI7 | Unconventional myosin-Ic (Myosin I beta) (MMI-beta) (MMIb) | EBI-11093786 | 0.35 |
| P12883 | Myosin-7 (Myosin heavy chain 7) (Myosin heavy chain slow isoform) (MyHC-slow) (Myosin heavy chain, cardiac muscle beta isoform) (MyHC-beta) | EBI-11098156 | 0.35 |
| P35579 | Myosin-9 (Cellular myosin heavy chain, type A) (Myosin heavy chain 9) (Myosin heavy chain, non-muscle IIa) (Non-muscle myosin heavy chain A) (NMMHC-A) (Non-muscle myosin heavy chain IIa) (NMMHC II-a) (NMMHC-IIA) | EBI-11098811 | 0.35 |
| Q96QS3 | Homeobox protein ARX (Aristaless-related homeobox) | EBI-11107478 | 0.35 |
| P16333 | Cytoplasmic protein NCK1 (NCK adaptor protein 1) (Nck-1) (SH2/SH3 adaptor protein NCK-alpha) | EBI-11108107 | 0.35 |
| Q9Z1Z0 | General vesicular transport factor p115 (Protein USO1 homolog) (Transcytosis-associated protein) (TAP) (Vesicle-docking protein) | EBI-11110688 | 0.35 |
| P47755 | F-actin-capping protein subunit alpha-2 (CapZ alpha-2) | EBI-11117728 | 0.35 |
| Q6ZNC8 | Lysophospholipid acyltransferase 1 (LPLAT 1) (1-acylglycerophosphocholine O-acyltransferase) (EC 2.3.1.23) (1-acylglycerophosphoethanolamine O-acyltransferase) (EC 2.3.1.n7) (1-acylglycerophosphoserine O-acyltransferase MBOAT1) (EC 2.3.1.n6) (Lysophosphatidylserine acyltransferase) (LPSAT) (Lyso-PS acyltransferase) (Membrane-bound O-acyltransferase domain-containing protein 1) (O-acyltransferase domain-containing protein 1) | EBI-11121915 | 0.35 |
| P46940 | Ras GTPase-activating-like protein IQGAP1 (p195) | EBI-11132927 | 0.35 |
| Q99615 | DnaJ homolog subfamily C member 7 (Tetratricopeptide repeat protein 2) (TPR repeat protein 2) | EBI-11136121 | 0.35 |
| P62140 | Serine/threonine-protein phosphatase PP1-beta catalytic subunit (PP-1B) (PPP1CD) (EC 3.1.3.16) (EC 3.1.3.53) | EBI-11142496 | 0.35 |
| Q5BJF6 | Outer dense fiber protein 2 (Cenexin) (Outer dense fiber of sperm tails protein 2) | EBI-11367291 | 0.27 |
| Q86X19 | Transmembrane protein 17 | EBI-11372615 | 0.27 |
| Q9P0N5 | Transmembrane protein 216 | EBI-11398030 | 0.27 |
| Q6P5F9 | Exportin-1 (Exp1) (Chromosome region maintenance 1 protein homolog) | EBI-11603310 | 0.35 |
| Q96FJ2 | Dynein light chain 2, cytoplasmic (8 kDa dynein light chain b) (DLC8b) (Dynein light chain LC8-type 2) | EBI-12449804 | 0.51 |
| P03431 | RNA-directed RNA polymerase catalytic subunit (EC 2.7.7.48) (Polymerase basic protein 1) (PB1) (RNA-directed RNA polymerase subunit P1) | EBI-12579531 | 0.35 |
| P03428 | Polymerase basic protein 2 (RNA-directed RNA polymerase subunit P3) | EBI-12579909 | 0.35 |
| I6T1Z2 | Non-structural protein 1 (NS1) | EBI-12581451 | 0.35 |
| Q5EP37 | RNA-directed RNA polymerase catalytic subunit (EC 2.7.7.48) (Polymerase basic protein 1) (PB1) (RNA-directed RNA polymerase subunit P1) | EBI-12582677 | 0.35 |
| C5E526 | RNA-directed RNA polymerase catalytic subunit (EC 2.7.7.48) (Polymerase basic protein 1) (PB1) (RNA-directed RNA polymerase subunit P1) | EBI-12584689 | 0.35 |
| Q1K9H5 | RNA-directed RNA polymerase catalytic subunit (EC 2.7.7.48) (Polymerase basic protein 1) (PB1) (RNA-directed RNA polymerase subunit P1) | EBI-12588354 | 0.35 |
| B4URF7 | Polymerase basic protein 2 (RNA-directed RNA polymerase subunit P3) | EBI-12588729 | 0.35 |
| Q6IQ23 | Pleckstrin homology domain-containing family A member 7 (PH domain-containing family A member 7) | EBI-16398399 | 0.35 |
| Q96CW1 | AP-2 complex subunit mu (AP-2 mu chain) (Adaptin-mu2) (Adaptor protein complex AP-2 subunit mu) (Adaptor-related protein complex 2 subunit mu) (Clathrin assembly protein complex 2 mu medium chain) (Clathrin coat assembly protein AP50) (Clathrin coat-associated protein AP50) (HA2 50 kDa subunit) (Plasma membrane adaptor AP-2 50 kDa protein) | EBI-21520588 | 0.35 |
| O75379 | Vesicle-associated membrane protein 4 (VAMP-4) | EBI-21524155 | 0.35 |
| Q9UEU0 | Vesicle transport through interaction with t-SNAREs homolog 1B (Vesicle transport v-SNARE protein Vti1-like 1) (Vti1-rp1) | EBI-21525256 | 0.35 |
| Q9UNK0 | Syntaxin-8 | EBI-21615189 | 0.35 |
| Q9NSY1 | BMP-2-inducible protein kinase (BIKe) (EC 2.7.11.1) | EBI-21615189 | 0.35 |
| Q9H0L4 | Cleavage stimulation factor subunit 2 tau variant (CF-1 64 kDa subunit tau variant) (Cleavage stimulation factor 64 kDa subunit tau variant) (CSTF 64 kDa subunit tau variant) (TauCstF-64) | EBI-21615189 | 0.35 |
| Q96D71 | RalBP1-associated Eps domain-containing protein 1 (RalBP1-interacting protein 1) | EBI-21615189 | 0.35 |
| Q8WXE9 | Stonin-2 (Stoned B) | EBI-21615189 | 0.35 |
| Q8WU79 | Stromal membrane-associated protein 2 (Stromal membrane-associated protein 1-like) | EBI-21615189 | 0.35 |
| Q15311 | RalA-binding protein 1 (RalBP1) (76 kDa Ral-interacting protein) (Dinitrophenyl S-glutathione ATPase) (DNP-SG ATPase) (EC 7.6.2.2, EC 7.6.2.3) (Ral-interacting protein 1) | EBI-21615189 | 0.35 |
| Q10567 | AP-1 complex subunit beta-1 (Adaptor protein complex AP-1 subunit beta-1) (Adaptor-related protein complex 1 subunit beta-1) (Beta-1-adaptin) (Beta-adaptin 1) (Clathrin assembly protein complex 1 beta large chain) (Golgi adaptor HA1/AP1 adaptin beta subunit) | EBI-21615189 | 0.35 |
| P53675 | Clathrin heavy chain 2 (Clathrin heavy chain on chromosome 22) (CLH-22) | EBI-21615189 | 0.35 |
| O95782 | AP-2 complex subunit alpha-1 (100 kDa coated vesicle protein A) (Adaptor protein complex AP-2 subunit alpha-1) (Adaptor-related protein complex 2 subunit alpha-1) (Alpha-adaptin A) (Alpha1-adaptin) (Clathrin assembly protein complex 2 alpha-A large chain) (Plasma membrane adaptor HA2/AP2 adaptin alpha A subunit) | EBI-21615189 | 0.35 |
| O94973 | AP-2 complex subunit alpha-2 (100 kDa coated vesicle protein C) (Adaptor protein complex AP-2 subunit alpha-2) (Adaptor-related protein complex 2 subunit alpha-2) (Alpha-adaptin C) (Alpha2-adaptin) (Clathrin assembly protein complex 2 alpha-C large chain) (Huntingtin yeast partner J) (Huntingtin-interacting protein 9) (HIP-9) (Huntingtin-interacting protein J) (Plasma membrane adaptor HA2/AP2 adaptin alpha C subunit) | EBI-21615189 | 0.35 |
| O00443 | Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha (PI3K-C2-alpha) (PtdIns-3-kinase C2 subunit alpha) (EC 2.7.1.137) (EC 2.7.1.153) (EC 2.7.1.154) (Phosphoinositide 3-kinase-C2-alpha) | EBI-21615189 | 0.35 |
| B9A025 | Lysyl oxidase homolog (EC 1.4.3.13) | EBI-21615189 | 0.35 |
| Q9UJ41 | Rab5 GDP/GTP exchange factor (RAP1) (Rabaptin-5-associated exchange factor for Rab5) (Rabex-5) | EBI-21644136 | 0.35 |
| Q96T17 | MAP7 domain-containing protein 2 | EBI-21796065 | 0.35 |
| Q9UJY4 | ADP-ribosylation factor-binding protein GGA2 (Gamma-adaptin-related protein 2) (Golgi-localized, gamma ear-containing, ARF-binding protein 2) (VHS domain and ear domain of gamma-adaptin) (Vear) | EBI-21886169 | 0.35 |
| O88384 | Vesicle transport through interaction with t-SNAREs homolog 1B (Vesicle transport v-SNARE protein Vti1-like 1) (Vti1-rp1) | EBI-15671994 | 0.65 |
| Q01968 | Inositol polyphosphate 5-phosphatase OCRL (EC 3.1.3.36) (EC 3.1.3.56) (Inositol polyphosphate 5-phosphatase OCRL-1) (OCRL-1) (Lowe oculocerebrorenal syndrome protein) (Phosphatidylinositol 3,4,5-triphosphate 5-phosphatase) (EC 3.1.3.86) | EBI-16412089 | 0.35 |
| Q14684 | Ribosomal RNA processing protein 1 homolog B (RRP1-like protein B) | EBI-16686997 | 0.35 |
| O15155 | BET1 homolog (hBET1) (Golgi vesicular membrane-trafficking protein p18) | EBI-16788067 | 0.27 |
| P11279 | Lysosome-associated membrane glycoprotein 1 (LAMP-1) (Lysosome-associated membrane protein 1) (CD107 antigen-like family member A) (CD antigen CD107a) | EBI-16794808 | 0.27 |
| O43493 | Trans-Golgi network integral membrane protein 2 (Trans-Golgi network glycoprotein 46) (TGN38 homolog) (hTGN46) (Trans-Golgi network glycoprotein 48) (hTGN48) (Trans-Golgi network glycoprotein 51) (hTGN51) (Trans-Golgi network protein 2) | EBI-16800265 | 0.42 |
| P14404 | Histone-lysine N-methyltransferase MECOM (EC 2.1.1.367) (Ecotropic virus integration site 1 protein) (EVI-1) (MDS1 and EVI1 complex locus protein) (Myelodysplasia syndrome 1 protein homolog) | EBI-21026252 | 0.35 |
| Q5T7N2 | LINE-1 type transposase domain-containing protein 1 (ES cell-associated protein 11) | EBI-20993270 | 0.35 |
| Q9NPJ6 | Mediator of RNA polymerase II transcription subunit 4 (Activator-recruited cofactor 36 kDa component) (ARC36) (Mediator complex subunit 4) (TRAP/SMCC/PC2 subunit p36 subunit) (Vitamin D3 receptor-interacting protein complex 36 kDa component) (DRIP36) | EBI-25472202 | 0.27 |
| Q9Y586 | Protein mab-21-like 2 | EBI-21261050 | 0.35 |
| G3V2R1 | Protein Smaug homolog 1 (Sterile alpha motif domain containing 4A, isoform CRA_a) | EBI-21264254 | 0.35 |
| O84226 | IncA protein | EBI-22302652 | 0.40 |
| Q9C0B5 | Palmitoyltransferase ZDHHC5 (EC 2.3.1.225) (Zinc finger DHHC domain-containing protein 5) (DHHC-5) (Zinc finger protein 375) | EBI-25636144 | 0.35 |
| O76024 | Wolframin | EBI-25897869 | 0.56 |
| O60333 | Kinesin-like protein KIF1B (Klp) | EBI-25915115 | 0.56 |
| O43464 | Serine protease HTRA2, mitochondrial (EC 3.4.21.108) (High temperature requirement protein A2) (HtrA2) (Omi stress-regulated endoprotease) (Serine protease 25) (Serine proteinase OMI) | EBI-27050249 | 0.35 |
| Q96LU5 | Mitochondrial inner membrane protease subunit 1 (EC 3.4.21.-) (IMP1-like protein) | EBI-27050332 | 0.35 |
| Q96T52 | Mitochondrial inner membrane protease subunit 2 (EC 3.4.21.-) (IMP2-like protein) | EBI-27050444 | 0.35 |
| F1PAA9 | Cadherin-1 (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) [Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3] | EBI-27079701 | 0.27 |
| A0A0H3NFP4 | SPI-2 type III secretion system effector SifA (Type III secretion system effector protein-necessary for Sif formation and maintaining the SCV. Has GAP activity) | EBI-27055788 | 0.27 |
| A0A0H3NB75 | Pathogenicity island 2 effector protein SseG (Type III secretion system effector protein-modulates the positioning of the SCV) | EBI-27055983 | 0.27 |
| P35226 | Polycomb complex protein BMI-1 (Polycomb group RING finger protein 4) (RING finger protein 51) | EBI-27108918 | 0.35 |
| Q99592 | Zinc finger and BTB domain-containing protein 18 (58 kDa repressor protein) (Transcriptional repressor RP58) (Translin-associated zinc finger protein 1) (TAZ-1) (Zinc finger protein 238) (Zinc finger protein C2H2-171) | EBI-27093179 | 0.35 |
| P80192 | Mitogen-activated protein kinase kinase kinase 9 (EC 2.7.11.25) (Mixed lineage kinase 1) | EBI-28938802 | 0.35 |
| Q5TCX8 | Mitogen-activated protein kinase kinase kinase 21 (EC 2.7.11.25) (Mitogen-activated protein kinase kinase kinase MLK4) (Mixed lineage kinase 4) | EBI-28941668 | 0.35 |
| Q9BYP7 | Serine/threonine-protein kinase WNK3 (EC 2.7.11.1) (Protein kinase lysine-deficient 3) (Protein kinase with no lysine 3) | EBI-28946054 | 0.35 |
| Q9H3S7 | Tyrosine-protein phosphatase non-receptor type 23 (EC 3.1.3.48) (His domain-containing protein tyrosine phosphatase) (HD-PTP) (Protein tyrosine phosphatase TD14) (PTP-TD14) | EBI-27114830 | 0.35 |
| Q9Y6R9 | Centrosomal protein CCDC61 (Coiled-coil domain-containing protein 61) (VFL3 homolog) | EBI-27132749 | 0.35 |
| P63010 | AP-2 complex subunit beta (AP105B) (Adaptor protein complex AP-2 subunit beta) (Adaptor-related protein complex 2 subunit beta) (Beta-2-adaptin) (Beta-adaptin) (Clathrin assembly protein complex 2 beta large chain) (Plasma membrane adaptor HA2/AP2 adaptin beta subunit) | EBI-30816421 | 0.44 |
| P54756 | Ephrin type-A receptor 5 (EC 2.7.10.1) (Brain-specific kinase) (EPH homology kinase 1) (EHK-1) (EPH-like kinase 7) (EK7) (hEK7) | EBI-32720907 | 0.27 |
| Q15375 | Ephrin type-A receptor 7 (EC 2.7.10.1) (EPH homology kinase 3) (EHK-3) (EPH-like kinase 11) (EK11) (hEK11) | EBI-32721052 | 0.27 |
| P11362 | Fibroblast growth factor receptor 1 (FGFR-1) (EC 2.7.10.1) (Basic fibroblast growth factor receptor 1) (BFGFR) (bFGF-R-1) (Fms-like tyrosine kinase 2) (FLT-2) (N-sam) (Proto-oncogene c-Fgr) (CD antigen CD331) | EBI-32721578 | 0.27 |
| P21802 | Fibroblast growth factor receptor 2 (FGFR-2) (EC 2.7.10.1) (K-sam) (KGFR) (Keratinocyte growth factor receptor) (CD antigen CD332) | EBI-32721907 | 0.27 |
| P22455 | Fibroblast growth factor receptor 4 (FGFR-4) (EC 2.7.10.1) (CD antigen CD334) | EBI-32722168 | 0.27 |
| Q16288 | NT-3 growth factor receptor (EC 2.7.10.1) (GP145-TrkC) (Trk-C) (Neurotrophic tyrosine kinase receptor type 3) (TrkC tyrosine kinase) | EBI-32724526 | 0.27 |
| P07949 | Proto-oncogene tyrosine-protein kinase receptor Ret (EC 2.7.10.1) (Cadherin family member 12) (Proto-oncogene c-Ret) [Cleaved into: Soluble RET kinase fragment; Extracellular cell-membrane anchored RET cadherin 120 kDa fragment] | EBI-32725031 | 0.27 |
| P03372 | Estrogen receptor (ER) (ER-alpha) (Estradiol receptor) (Nuclear receptor subfamily 3 group A member 1) | EBI-34581889 | 0.35 |
Database | Links |
| UNIPROT | Q14677 B7Z6F8 D3DQJ6 Q8NAF1 Q96E05 |
| PDB | 1XGW 2QY7 2V8S |
| Pfam | PF01417 |
| PROSITE | PS50942 |
| OMIM | 607265 |
| DisGeNET | 9685 |
National and Kapodistrian University of Athens
Department of Biology
Biophysics & Bioinformatics Laboratory