Transducer of Cdc42-dependent actin assembly protein 1 homolog - Caenorhabditis elegans

Transducer of Cdc42-dependent actin assembly protein 1 homolog (Caenorhabditis elegans)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	Transducer of Cdc42-dependent actin assembly protein 1 homolog
Accession Code	Q19253
Gene	toca
Organism	Caenorhabditis elegans (Taxonomy: 6239)
Part of Reference Proteome?	Yes
Sequence (Length: 592)
MNDSCSWDQLWDQQGTLNEYTGKGIDLLERIMAYSKERASIELEYSSKLKALSKKTAMKMKSESELWNSVSYVKGFHDVIAGIVPVATQHELIAENLKSAVIPFTTQKIAEYRVAKKQLESDNSNLGKQL RMVIDEMAKSHKEYVKCYKETEAAMLKYAKAEKNMDISRLELEKTKNNYQQKCGMLEESKQTYAVMTTKANEEQSAHYDRKLPQLLDNYKKLHTNRILDTVEILSKCVEAESCVNQIIASCHNDMRRDIG LIDPSRDANLVVENMKSGHPVPQPFVFEDLGHPQDRSSFMGGGASGPAGSMDGMDATMKKGGTLMSKNGKGVARKQSMHQKFFGGGTADKKTDSGDYGTLPPQQRARKIAGKISDLEKEKDRATQSREGV SKMQAAYRENPKLGNPSDCDAQLAQYGHEIDALSNQIQKFKILLDDVNAQLGAGGLSATSVGGSDTPPSIRSVSSASSGVTSRVNTINDAHRTNGGVGGGRRESFSGSNGGSDTDPTINGNGHGRDELYE ECSNPNPVLGEAIAQFAFDGAQDGTIRMEANEKLWLIEKDEGDGWTRVRKENNSADGFVPSSYLKVTWFGKV

Subcellular Location

Description
Cell junction {Experimental EvidencePubMed:19798448, Experimental EvidencePubMed:23150597}. Apical cell membrane {Experimental EvidencePubMed:19798448, ECO:0000269\|PubMed:25775511}; Peripheral membrane protein {Experimental EvidencePubMed:19798448, ECO:0000269\|PubMed:25775511}; Cytoplasmic side {Experimental EvidencePubMed:19798448, ECO:0000269\|PubMed:25775511}. Basolateral cell membrane {Experimental EvidencePubMed:19798448, ECO:0000269\|PubMed:25775511}; Peripheral membrane protein {Experimental EvidencePubMed:19798448, ECO:0000269\|PubMed:25775511}; Cytoplasmic side {Experimental EvidencePubMed:19798448, ECO:0000269\|PubMed:25775511}. Cytoplasmic vesicle {Experimental EvidencePubMed:19798448}. Cytoplasm {Experimental EvidencePubMed:23150597, ECO:0000269\|PubMed:25775511}. Cytoplasm, perinuclear region {Experimental EvidencePubMed:23150597}. Recycling endosome {ECO:0000269\|PubMed:25775511}. Note=Co-localizes with ajm-1 at cell junctions (PubMed:19798448). Co-localizes with toca-2, rme-1, cdc-42 and wve-1 on recycling endosomes (PubMed:25775511). {Experimental EvidencePubMed:19798448, ECO:0000269\|PubMed:25775511}.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Peripheral	UniProt	Sequence Analysis
Assigned Ontology terms

Cellular Component	Apical Plasma Membrane (GO:0016324) Basolateral Plasma Membrane (GO:0016323) Cell-Cell Junction (GO:0005911) Intracellular Vesicle (GO:0097708) Perinuclear Region Of Cytoplasm (GO:0048471) Plasma Membrane (GO:0005886) Recycling Endosome (GO:0055037)

Biology & Function

Description
Plays a role in protein trafficking, actin organization and embryonic morphogenesis (PubMed:19798448). Potentially acts as cdc-42 effector (PubMed:25775511). May play a role in hypodermal P-cell nuclear positioning (PubMed:23150597). Together with toca-2, is required for protein trafficking regulating yolk protein clathrin- mediated endocytosis by oocytes during oogenesis and retrograde recycling and the sorting of recycling endosome cargo proteins such as mig-14 (PubMed:19798448, PubMed:25775511). Also, together with toca-2, controls the distribution of actin at cell junctions (PubMed:19798448, PubMed:26578656). {Experimental EvidencePubMed:19798448, Experimental EvidencePubMed:23150597, Experimental EvidencePubMed:25775511, Experimental EvidencePubMed:26578656}.
Assigned Ontology terms

Biological Process	Embryonic Ectodermal Digestive Tract Morphogenesis (GO:0048613) Endocytosis (GO:0006897) Negative Regulation Of Protein Localization To Adherens Junction (GO:1904703) Positive Regulation Of Clathrin-Dependent Endocytosis (GO:2000370) Positive Regulation Of Oviposition (GO:1901046) Regulation Of Actin Cytoskeleton Organization (GO:0032956) Signal Transduction (GO:0007165)
Molecular Function

Protein-Protein Interactions

Interactions with other proteins (29 interactors)

Partner (UniProt)		IntAct	Confidence score
P39055	Dynamin (EC 3.6.5.5)	EBI-6533636	0.37
A0A1C3NSL9	Apical junction molecule	EBI-6533681	0.37
O17578	F-box domain-containing protein	EBI-6533651	0.37
Q09442	Splicing factor 3B subunit 4 (Spliceosome-associated protein 49)	EBI-6533666	0.37
G5ED57	Kunitz/Bovine pancreatic trypsin inhibitor domain protein	EBI-6533743	0.37
Q9XZI6	Phosphatidylinositol-binding clathrin assembly protein unc-11 (AP180-like adaptor protein) (Uncoordinated protein 11)	EBI-6533696	0.37
B7WN72	Protein shank	EBI-6533711	0.37
Q93343	RING-type domain-containing protein	EBI-6533728	0.37
Q20877	Apple domain-containing protein	EBI-6533788	0.37
Q19782	Intermediate filament protein ifd-2 (Cel IF D2) (Intermediate filament protein D2) (IF-D2)	EBI-6533758	0.37
Q20010	Spindle assembly abnormal protein 5	EBI-6533773	0.37
G5EFY6	WD_REPEATS_REGION domain-containing protein	EBI-6533833	0.37
Q94246	GEI-4 (Four) Interacting protein	EBI-6533803	0.37
O01900	TFIIS-type domain-containing protein	EBI-6533818	0.37
G5EF97	Branchpoint-bridging protein	EBI-6533880	0.37
Q9U304	RNA Binding Motif protein homolog	EBI-6533863	0.37
G5EC72	ALP/Enigma encoding	EBI-6533848	0.37
A8WFL0	LIM zinc-binding domain-containing protein	EBI-6533925	0.37
A5PEX6	MATH domain-containing protein	EBI-6533895	0.37
Q4VNJ8	LIN-65S	EBI-6533910	0.37
Q23571	Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial (EC 2.3.1.168) (Branched-chain alpha-keto acid dehydrogenase complex component E2) (Dihydrolipoamide branched-chain transacylase E2)	EBI-6533942	0.37
O17577	F-box domain-containing protein	EBI-6542246	0.37
O61701	FH2 domain-containing protein	EBI-6542293	0.37
Q95QQ9	CortBP2 domain-containing protein	EBI-6542278	0.37
Q1XFY2	RNA polymerase II-associated factor 1 homolog	EBI-6542308	0.37
G5ECJ4	Mec-8 protein	EBI-6542323	0.37
F5GUF0	WH2 domain-containing protein	EBI-6542340	0.37
Q95QA6	Protein pat-12 (Paralyzed arrest at two-fold 12 protein)	EBI-6542370	0.37
A8XQ35	Regulator of SYnapse formation	EBI-6542387	0.37

Cross-References

Database	Links
UNIPROT	Q19253 Q8MQ82
Pfam	PF00611 PF00018
PROSITE	PS51741 PS51860 PS50002

NucEnvDB

NucEnvDB

A database of Nuclear Envelope Proteins and their Interactions

Transducer of Cdc42-dependent actin assembly protein 1 homolog (Caenorhabditis elegans)

General Information

Protein Information

Subcellular Location

Description

Position in the Nuclear Envelope

Membrane Topology

Assigned Ontology terms

Biology & Function

Description

Assigned Ontology terms

Protein-Protein Interactions

Interactions with other proteins (29 interactors)

Cross-References

Database

Links

Transducer of Cdc42-dependent actin assembly protein 1 homolog (Caenorhabditis elegans)

General Information

Protein Information

Subcellular Location

Description Show

Position in the Nuclear Envelope

Membrane Topology

Assigned Ontology terms

Biology & Function

Description Hide

Assigned Ontology terms

Protein-Protein Interactions

Interactions with other proteins (29 interactors)

Cross-References

Database

Links

Description

Description