NucEnvDB

NucEnvDB

A database of Nuclear Envelope Proteins and their Interactions

Cytoplasmic dynein 1 intermediate chain - Drosophila melanogaster - NucEnvDB

Cytoplasmic dynein 1 intermediate chain (Drosophila melanogaster)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	Cytoplasmic dynein 1 intermediate chain
Accession Code	Q24246
Gene	sw
Organism	Drosophila melanogaster (Taxonomy: 7227)
Part of Reference Proteome?	Yes
Sequence (Length: 663)
MDRKAELERKKAKLAALREEKDRRRREKEIKDMEEAAGRIGGGAGIDKDQRKDLDEMLSSLGVAPVSEVLSSLSSVNSMT SDNSNTQTPDASLQATVNGQSGGKKQPLNLSVYNVQATNIPPKETLVYTKQTQTTSTGGGNGDVLSCHSSPLSGYMEDWW RPRKAHATDYYDEYNLNPGLEWEDEFTDDEESSLQNLGNGFTSKLPPGYLTHGLPTVKDVAPAITPLEIKKETEVKKEVN ELSEEQKQMIILSENFQRFVVRAGRVIERALSENVDIYTDYIGGGDSEEANDERSHARLSLNRVFYDERWSKNRCITSMD WSTHFPELVVGSYHNNEESPNEPDGVVMVWNTKFKKSTPEDVFHCQSAVMSTCFAKFNPNLILGGTYSGQIVLWDNRVQK RTPIQRTPLSAAAHTHPVYCLQMVGTQNAHNVISISSDGKLCSWSLDMLSQPQDTLELQQRQSKAIAITSMAFPANEINS LVMGSEDGYVYSASRHGLRSGVNEVYERHLGPITGISTHYNQLSPDFGHLFLTSSIDWTIKLWSLKDTKPLYSFEDNSDY VMDVAWSPVHPALFAAVDGSGRLDLWNLNQDTEVPTASIVVAGAPALNRVSWTPSGLHVCIGDEAGKLYVYDVAENLAQP SRDEWSRFNTHLSEIKMNQSDEV

Structure Viewer (PDB: 3FM7)

Subcellular Location

Description
Cytoplasm, cytoskeleton {Experimental EvidencePubMed:9774695}. [Isoform 2c]: Lysosome membrane; Peripheral membrane protein; Cytoplasmic side. Note=Aggregates in cytoplasm around lysosomes. [Isoform 2a]: Nucleus membrane; Peripheral membrane protein; Cytoplasmic side. Note=Aggregates in cytoplasm around the nucleus. [Isoform 2b]: Nucleus membrane; Peripheral membrane protein; Cytoplasmic side. Note=Aggregates in cytoplasm around the nucleus.
Position in the Nuclear Envelope
Location	Location ID	Description
Nuclear Envelope	SL-0178	The nuclear envelope is a membrane system which surrounds the nucleoplasm of eukaryotic cells. It is composed of the nuclear lamina, nuclear pore complexes and two nuclear membranes. The space between the two membranes is called the nuclear intermembrane space.
Nuclear Membrane	SL-0182	The membrane surrounding the nucleus. This term is used when it is not known if the protein is found in or associated with the inner or outer nuclear membrane.
Membrane Topology
Topology	Source	Annotation Type
Peripheral	UniProt	Sequence Analysis
Assigned Ontology terms

Cellular Component	Cytoplasmic Dynein Complex (GO:0005868) Lysosomal Membrane (GO:0005765) Microtubule (GO:0005874) Neuron Projection (GO:0043005) Nuclear Membrane (GO:0031965) Protein-Containing Complex (GO:0032991)

Biology & Function

Description
Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. The intermediate chains mediate the help dynein bind to dynactin 150 kDa component (By similarity). {By Similarity, Experimental EvidencePubMed:11071907}.
Assigned Ontology terms

Biological Process	Axo-Dendritic Transport (GO:0008088) Cellularization (GO:0007349) Centrosome Localization (GO:0051642) Eye Photoreceptor Cell Differentiation (GO:0001754) Microtubule Cytoskeleton Organization (GO:0000226) Microtubule-Based Movement (GO:0007018) Protein Localization To Kinetochore (GO:0034501) Sperm Individualization (GO:0007291) Spindle Organization (GO:0007051) Transport Along Microtubule (GO:0010970)
Molecular Function	Dynactin Binding (GO:0034452) Dynein Heavy Chain Binding (GO:0045504) Dynein Light Chain Binding (GO:0045503) Molecular Adaptor Activity (GO:0060090)

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (1 interactors)

Partner (NucEnvDB)		IntAct	Confidence score
Q24568	Netrin-B	EBI-9944837	0.35
Interactions with other proteins (6 interactors)

Partner (UniProt)		IntAct	Confidence score
Q8T0I9	GH27479p (Thrombospondin, isoform C) (Thrombospondin, isoform D) (Thrombospondin, isoform E)	EBI-213466	0.00
Q4V5A7	IP14655p (Testis-specifically expressed bromodomain containing protein-2)	EBI-253285	0.00
Q9XZ56	Eukaryotic translation initiation factor 4E-binding protein (4E-BP) (d4E-BP) (eIF4E-binding protein) (4E-binding protein Thor) (dThor)	EBI-9919028	0.46
O61307	Teneurin-m (Tenm) (Odd Oz protein) (Tenascin-like protein)	EBI-9921261	0.35
P18431	Protein kinase shaggy (EC 2.7.11.1) (Protein zeste-white 3)	EBI-9925534	0.35
Q9VLS7	LD21067p (Phosphatidic acid phospholipase A1, isoform A (EC 3.1.1.-))	EBI-9929131	0.35

Cross-References

Database	Links
UNIPROT	Q24246 O96508 O96510 O96511 O96512 O96513 O96514 O96515 O96516 Q5U0Z1 Q86BQ5 Q9NG49 Q9TZR7 Q9TZR8 Q9TZR9 Q9TZS0 Q9VR78
PDB	2P2T 3FM7 3L9K
Pfam	PF11540
PROSITE	PS50082 PS50294

Powered by W3.css | Privacy Notice

x

This website uses cookies to improve user experience. By using NucEnvDB you consent to all cookies in accordance with our privacy policy. OK