Inverted formin-2 - Homo sapiens

Inverted formin-2 (Homo sapiens)

FASTA TEXT XML

Subcellular Location Biology & Function Disease Associations Interactions Cross-References

General Information

Protein Information
Protein Name	Inverted formin-2
Accession Code	Q27J81
Gene	INF2
Organism	Homo sapiens \| Human (Taxonomy: 9606)
Part of Reference Proteome?	Yes
Sequence (Length: 1249)
MSVKEGAQRKWAALKEKLGPQDSDPTEANLESADPELCIRLLQMPSVVNYSGLRKRLEGSDGGWMVQFLEQSGLDLLLEALARLSGRGVARISDALLQLTCVSCVRAVMNSRQGIEYILSNQGYVRQLSQ ALDTSNVMVKKQVFELLAALCIYSPEGHVLTLDALDHYKTVCSQQYRFSIVMNELSGSDNVPYVVTLLSVINAVILGPEDLRARTQLRNEFIGLQLLDVLARLRDLEDADLLIQLEAFEEAKAEDEEELL RVSGGVDMSSHQEVFASLFHKVSCSPVSAQLLSVLQGLLHLEPTLRSSQLLWEALESLVNRAVLLASDAQECTLEEVVERLLSVKGRPRPSPLVKAHKSVQANLDQSQRGSSPQNTTTPKPSVEGQQPAA AAACEPVDHAQSESILKVSQPRALEQQASTPPPPPPPPLLPGSSAEPPPPPPPPPLPSVGAKALPTAPPPPPLPGLGAMAPPAPPLPPPLPGSCEFLPPPPPPLPGLGCPPPPPPLLPGMGWGPPPPPPP LLPCTCSPPVAGGMEEVIVAQVDHGLGSAWVPSHRRVNPPTLRMKKLNWQKLPSNVAREHNSMWASLSSPDAEAVEPDFSSIERLFSFPAAKPKEPTMVAPRARKEPKEITFLDAKKSLNLNIFLKQFKC SNEEVAAMIRAGDTTKFDVEVLKQLLKLLPEKHEIENLRAFTEERAKLASADHFYLLLLAIPCYQLRIECMLLCEGAAAVLDMVRPKAQLVLAACESLLTSRQLPIFCQLILRIGNFLNYGSHTGDADGF KISTLLKLTETKSQQNRVTLLHHVLEEAEKSHPDLLQLPRDLEQPSQAAGINLEIIRSEASSNLKKLLETERKVSASVAEVQEQYTERLQASISAFRALDELFEAIEQKQRELADYLCEDAQQLSLEDTF STMKAFRDLFLRALKENKDRKEQAAKAERRKQQLAEEEARRPRGEDGKPVRKGPGKQEEVCVIDALLADIRKGFQLRKTARGRGDTDGGSKAASMDPPRATEPVATSNPAGDPVGSTRCPASEPGLDATT ASESRGWDLVDAVTPGPQPTLEQLEEGGPRPLERRSSWYVDASDVLTTEDPQCPQPLEGAWPVTLGDAQALKPLKFSSNQPPAAGSSRQDAKDPTSLLGVLQAEADSTSEGLEDAVHSRGARPPAAGPGG DEDEDEEDTAPESALDTSLDKSFSEDAVTDSSGSGTLPRARGRASKGTGKRRKKRPSRSQEEVPPDSDDNKTKKLCVIQ

Subcellular Location

Description
Cytoplasm, perinuclear region {Experimental EvidencePubMed:20023659}.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Unknown	UniProt	Sequence Analysis
Assigned Ontology terms

Cellular Component	Perinuclear Region Of Cytoplasm (GO:0048471)

Biology & Function

Description
Severs actin filaments and accelerates their polymerization and depolymerization. {By Similarity}.
Assigned Ontology terms

Biological Process	Actin Cytoskeleton Organization (GO:0030036) Regulation Of Mitochondrial Fission (GO:0090140) Regulation Of Small GTPase Mediated Signal Transduction (GO:0051056)
Molecular Function	Actin Binding (GO:0003779) Small GTPase Binding (GO:0031267)

Disease associations

Description
Focal segmental glomerulosclerosis 5 (FSGS5) [MIM:613237]: A renal pathology defined by the presence of segmental sclerosis in glomeruli and resulting in proteinuria, reduced glomerular filtration rate and progressive decline in renal function. Renal insufficiency often progresses to end-stage renal disease, a highly morbid state requiring either dialysis therapy or kidney transplantation. {Experimental EvidencePubMed:20023659, Experimental EvidencePubMed:21258034, Experimental EvidencePubMed:21866090, Experimental EvidencePubMed:22971997, Experimental EvidencePubMed:23014460, Experimental EvidencePubMed:25165188}. Note=The disease is caused by variants affecting the gene represented in this entry. Charcot-Marie-Tooth disease, dominant, intermediate type, E (CMTDIE) [MIM:614455]: A form of Charcot-Marie-Tooth disease, a disorder of the peripheral nervous system, characterized by progressive weakness and atrophy, initially of the peroneal muscles and later of the distal muscles of the arms. The dominant intermediate type E is characterized by clinical and pathologic features intermediate between demyelinating and axonal peripheral neuropathies, and motor median nerve conduction velocities ranging from 25 to 45 m/sec. Patients additionally manifest focal segmental glomerulonephritis, proteinuria, progression to end-stage renal disease, and a characteristic histologic pattern on renal biopsy. {Experimental EvidencePubMed:22187985, Experimental EvidencePubMed:24174593, Experimental EvidencePubMed:24750328, Experimental EvidencePubMed:25165188, ECO:0000269\|PubMed:25676889}. Note=The disease is caused by variants affecting the gene represented in this entry.
Database Associations
OMIM	610982 613237 614455
DisGeNET	64423

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (2 interactors)

Partner (NucEnvDB)		IntAct	Confidence score
Q9WMX2	RNA-directed RNA polymerase	EBI-9081849	0.37
O14976	Cyclin-G-associated kinase	EBI-11150908	0.35
Interactions with other proteins (68 interactors)

Partner (UniProt)		IntAct	Confidence score
P84089	Enhancer of rudimentary homolog (Mer)	EBI-2557894	0.40
A0A0F7RE19	Putative S-layer protein	EBI-2831512	0.00
A0A380PMD7	Citrate synthase	EBI-2847144	0.00
Q712K3	Ubiquitin-conjugating enzyme E2 R2 (EC 2.3.2.23) (E2 ubiquitin-conjugating enzyme R2) (Ubiquitin carrier protein R2) (Ubiquitin-conjugating enzyme E2-CDC34B) (Ubiquitin-protein ligase R2)	EBI-7412118	0.37
P68400	Casein kinase II subunit alpha (CK II alpha) (EC 2.7.11.1)	EBI-5309997	0.44
P03220	Protein BGLF3	EBI-11722152	0.35
P03225	Protein BDLF2	EBI-11722220	0.35
P06428	Protein E6	EBI-11722493	0.35
P0CK56	Uncharacterized protein BDLF4	EBI-11725466	0.35
P0CK58	Apoptosis regulator BALF1	EBI-11732874	0.35
P35579	Myosin-9 (Cellular myosin heavy chain, type A) (Myosin heavy chain 9) (Myosin heavy chain, non-muscle IIa) (Non-muscle myosin heavy chain A) (NMMHC-A) (Non-muscle myosin heavy chain IIa) (NMMHC II-a) (NMMHC-IIA)	EBI-11004631	0.35
Q9NQW6	Anillin	EBI-11009421	0.35
O08917	Flotillin-1	EBI-11025136	0.35
Q60634	Flotillin-2 (Epidermal surface antigen) (ESA) (Membrane component chromosome 17 surface marker 1 homolog)	EBI-11025478	0.35
Q92614	Unconventional myosin-XVIIIa (Molecule associated with JAK3 N-terminus) (MAJN) (Myosin containing a PDZ domain) (Surfactant protein receptor SP-R210) (SP-R210)	EBI-11030093	0.35
O00159	Unconventional myosin-Ic (Myosin I beta) (MMI-beta) (MMIb)	EBI-11030803	0.35
Q96H55	Unconventional myosin-XIX (Myosin head domain-containing protein 1)	EBI-11031416	0.35
P21333	Filamin-A (FLN-A) (Actin-binding protein 280) (ABP-280) (Alpha-filamin) (Endothelial actin-binding protein) (Filamin-1) (Non-muscle filamin)	EBI-11038784	0.35
Q61879	Myosin-10 (Cellular myosin heavy chain, type B) (Myosin heavy chain 10) (Myosin heavy chain, non-muscle IIb) (Non-muscle myosin heavy chain B) (NMMHC-B) (Non-muscle myosin heavy chain IIb) (NMMHC II-b) (NMMHC-IIB)	EBI-11041929	0.35
P60710	Actin, cytoplasmic 1 (Beta-actin) (EC 3.6.4.-) [Cleaved into: Actin, cytoplasmic 1, N-terminally processed]	EBI-11045267	0.35
Q80X90	Filamin-B (FLN-B) (ABP-280-like protein) (Actin-binding-like protein) (Beta-filamin)	EBI-11053320	0.35
Q9ERG0	LIM domain and actin-binding protein 1 (Epithelial protein lost in neoplasm) (mEPLIN)	EBI-11054044	0.35
Q9UHB6	LIM domain and actin-binding protein 1 (Epithelial protein lost in neoplasm)	EBI-11058729	0.35
Q9D6P8	Calmodulin-like protein 3	EBI-11062262	0.35
Q9JHJ0	Tropomodulin-3 (Ubiquitous tropomodulin) (U-Tmod)	EBI-11063313	0.35
P58771	Tropomyosin alpha-1 chain (Alpha-tropomyosin) (Tropomyosin-1)	EBI-11063826	0.35
Q9WUM4	Coronin-1C (Coronin-3)	EBI-11065690	0.35
Q16643	Drebrin (Developmentally-regulated brain protein)	EBI-11080402	0.35
Q8N3V7	Synaptopodin	EBI-11086992	0.35
Q8VDD5	Myosin-9 (Cellular myosin heavy chain, type A) (Myosin heavy chain 9) (Myosin heavy chain, non-muscle IIa) (Non-muscle myosin heavy chain A) (NMMHC-A) (Non-muscle myosin heavy chain IIa) (NMMHC II-a) (NMMHC-IIA)	EBI-11092730	0.35
Q9WTI7	Unconventional myosin-Ic (Myosin I beta) (MMI-beta) (MMIb)	EBI-11093786	0.35
P35749	Myosin-11 (Myosin heavy chain 11) (Myosin heavy chain, smooth muscle isoform) (SMMHC)	EBI-11098041	0.35
Q9NQX4	Unconventional myosin-Vc	EBI-11100755	0.35
Q91YI4	Beta-arrestin-2 (Arrestin beta-2)	EBI-11102575	0.35
Q9Z1Z0	General vesicular transport factor p115 (Protein USO1 homolog) (Transcytosis-associated protein) (TAP) (Vesicle-docking protein)	EBI-11112182	0.35
Q61166	Microtubule-associated protein RP/EB family member 1 (APC-binding protein EB1) (End-binding protein 1) (EB1)	EBI-11113235	0.35
P47755	F-actin-capping protein subunit alpha-2 (CapZ alpha-2)	EBI-11117728	0.35
P35611	Alpha-adducin (Erythrocyte adducin subunit alpha)	EBI-11118761	0.35
P46108	Adapter molecule crk (Proto-oncogene c-Crk) (p38)	EBI-11119999	0.35
Q80UG5	Septin-9 (SL3-3 integration site 1 protein)	EBI-11121465	0.35
P36873	Serine/threonine-protein phosphatase PP1-gamma catalytic subunit (PP-1G) (EC 3.1.3.16) (Protein phosphatase 1C catalytic subunit)	EBI-11128681	0.35
Q9P2B7	Cilia- and flagella-associated protein 97	EBI-11131339	0.35
P46940	Ras GTPase-activating-like protein IQGAP1 (p195)	EBI-11132927	0.35
P62140	Serine/threonine-protein phosphatase PP1-beta catalytic subunit (PP-1B) (PPP1CD) (EC 3.1.3.16) (EC 3.1.3.53)	EBI-11142496	0.35
P61160	Actin-related protein 2 (Actin-like protein 2)	EBI-11156891	0.35
Q9NYL9	Tropomodulin-3 (Ubiquitous tropomodulin) (U-Tmod)	EBI-21701240	0.35
P35080	Profilin-2 (Profilin II)	EBI-21776651	0.35
Q96DX4	RING finger and SPRY domain-containing protein 1	EBI-21834193	0.35
P62136	Serine/threonine-protein phosphatase PP1-alpha catalytic subunit (PP-1A) (EC 3.1.3.16)	EBI-16370519	0.35
P27824	Calnexin (IP90) (Major histocompatibility complex class I antigen-binding protein p88) (p90)	EBI-16788621	0.27
Q15388	Mitochondrial import receptor subunit TOM20 homolog (Mitochondrial 20 kDa outer membrane protein) (Outer mitochondrial membrane receptor Tom20)	EBI-16801791	0.27
Q9NS69	Mitochondrial import receptor subunit TOM22 homolog (hTom22) (1C9-2) (Translocase of outer membrane 22 kDa subunit homolog)	EBI-16802054	0.27
P30411	B2 bradykinin receptor (B2R) (BK-2 receptor)	EBI-20803487	0.37
Q14108	Lysosome membrane protein 2 (85 kDa lysosomal membrane sialoglycoprotein) (LGP85) (CD36 antigen-like 2) (Lysosome membrane protein II) (LIMP II) (Scavenger receptor class B member 2) (CD antigen CD36)	EBI-21264396	0.35
O84793	Leader (60) peptide-periplasmic	EBI-22302936	0.35
Q92685	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase (EC 2.4.1.258) (Asparagine-linked glycosylation protein 3 homolog) (Dol-P-Man-dependent alpha(1-3)-mannosyltransferase) (Dolichyl-P-Man:Man(5)GlcNAc(2)-PP-dolichyl mannosyltransferase) (Dolichyl-phosphate-mannose--glycolipid alpha-mannosyltransferase) (Not56-like protein)	EBI-25468462	0.37
Q9C0B5	Palmitoyltransferase ZDHHC5 (EC 2.3.1.225) (Zinc finger DHHC domain-containing protein 5) (DHHC-5) (Zinc finger protein 375)	EBI-25636144	0.35
Q5EP34	Polymerase acidic protein (EC 3.1.-.-) (RNA-directed RNA polymerase subunit P2)	EBI-25772822	0.35
P35226	Polycomb complex protein BMI-1 (Polycomb group RING finger protein 4) (RING finger protein 51)	EBI-27108918	0.35
Q99592	Zinc finger and BTB domain-containing protein 18 (58 kDa repressor protein) (Transcriptional repressor RP58) (Translin-associated zinc finger protein 1) (TAZ-1) (Zinc finger protein 238) (Zinc finger protein C2H2-171)	EBI-27093179	0.35
P11274	Breakpoint cluster region protein (EC 2.7.11.1) (Renal carcinoma antigen NY-REN-26)	EBI-28931791	0.35
Q8TAS1	Serine/threonine-protein kinase Kist (EC 2.7.11.1) (Kinase interacting with stathmin) (PAM COOH-terminal interactor protein 2) (P-CIP2) (U2AF homology motif kinase 1)	EBI-28943630	0.35
Q8TDX7	Serine/threonine-protein kinase Nek7 (EC 2.7.11.1) (Never in mitosis A-related kinase 7) (NimA-related protein kinase 7)	EBI-28943744	0.35
Q96GD4	Aurora kinase B (EC 2.7.11.1) (Aurora 1) (Aurora- and IPL1-like midbody-associated protein 1) (AIM-1) (Aurora/IPL1-related kinase 2) (ARK-2) (Aurora-related kinase 2) (STK-1) (Serine/threonine-protein kinase 12) (Serine/threonine-protein kinase 5) (Serine/threonine-protein kinase aurora-B)	EBI-28944360	0.35
Q99816	Tumor susceptibility gene 101 protein (ESCRT-I complex subunit TSG101)	EBI-30839695	0.44
Q9UM73	ALK tyrosine kinase receptor (EC 2.7.10.1) (Anaplastic lymphoma kinase) (CD antigen CD246)	EBI-32719830	0.27
P08069	Insulin-like growth factor 1 receptor (EC 2.7.10.1) (Insulin-like growth factor I receptor) (IGF-I receptor) (CD antigen CD221) [Cleaved into: Insulin-like growth factor 1 receptor alpha chain; Insulin-like growth factor 1 receptor beta chain]	EBI-32722947	0.27
P09619	Platelet-derived growth factor receptor beta (PDGF-R-beta) (PDGFR-beta) (EC 2.7.10.1) (Beta platelet-derived growth factor receptor) (Beta-type platelet-derived growth factor receptor) (CD140 antigen-like family member B) (Platelet-derived growth factor receptor 1) (PDGFR-1) (CD antigen CD140b)	EBI-32724964	0.27

Cross-References

Database	Links
UNIPROT	Q27J81 Q27J83 Q69YL8 Q6P1X7 Q6PK22 Q86TR7 Q9BRM1 Q9H6N1
Pfam	PF06367 PF06371 PF02181 PF02205
PROSITE	PS51444 PS51232 PS51082
OMIM	610982 613237 614455
DisGeNET	64423

Inverted formin-2 (Homo sapiens)

General Information

Protein Information

Subcellular Location

Description Show

Position in the Nuclear Envelope

Membrane Topology

Assigned Ontology terms

Biology & Function

Description Hide

Assigned Ontology terms

Disease associations

Description

Database Associations

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (2 interactors)

Interactions with other proteins (68 interactors)

Cross-References

Database

Links

Description

Description