NucEnvDB

A database of Nuclear Envelope Proteins and their Interactions

Interferon-inducible double-stranded RNA-dependent protein kinase activator A - Bos taurus - NucEnvDB

FASTA TEXT XML

Subcellular Location Biology & Function Cross-References

Protein Information
Protein Name	Interferon-inducible double-stranded RNA-dependent protein kinase activator A
Accession Code	Q2HJ92
Gene	PRKRA
Organism	Bos taurus \| Cattle (Taxonomy: 9913)
Part of Reference Proteome?	Yes
Sequence (Length: 313)
MSQSRHRAAAPPMEREDSGTFSLGKMITAKPGKTPIQVLHEYGMKTKNIPVYECERSDVQIHVPTFTFRVTVGDITCTGEGTSKKLAKHRAAEAAINILKANASICFAVPDPLMPDPSKQPKNQLNPIGS LQELAIHHGWRLPEYTLSQEGGPAHKREYTTICRLESFMETGKGASKKQAKRNAAEKFLAKFSNISPENHISLTNMVGHSLGCTWHSLRNSPGEKINLLKRSLLSIPNTDYIQLLSEIAKEQGFNITYLD IEELSANGQYQCLAELSTSPITVCHGSGISCSSAQSDAAHNALQYLKIIAERK

Description
Cytoplasm, perinuclear region {By Similarity}. Cytoplasm {By Similarity}.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Unknown	UniProt	Sequence Analysis
Assigned Ontology terms

Cellular Component	Cytoplasm (GO:0005737) Cytosol (GO:0005829) Intracellular Anatomical Structure (GO:0005622) Nucleoplasm (GO:0005654) Nucleus (GO:0005634) Perinuclear Region Of Cytoplasm (GO:0048471) RISC Complex (GO:0016442) RISC-Loading Complex (GO:0070578)

Description
Activates EIF2AK2/PKR in the absence of double-stranded RNA (dsRNA), leading to phosphorylation of EIF2S1/EFI2-alpha and inhibition of translation and induction of apoptosis. Required for siRNA production by DICER1 and for subsequent siRNA-mediated post- transcriptional gene silencing. Does not seem to be required for processing of pre-miRNA to miRNA by DICER1. Promotes UBC9-p53/TP53 association and sumoylation and phosphorylation of p53/TP53 at 'Lys- 386' at 'Ser-392' respectively and enhances its activity in a EIF2AK2/PKR-dependent manner (By similarity). {By Similarity}.
Assigned Ontology terms

Biological Process	Cellular Response To Oxidative Stress (GO:0034599) Middle Ear Morphogenesis (GO:0042474) Outer Ear Morphogenesis (GO:0042473) Positive Regulation Of Intrinsic Apoptotic Signaling Pathway (GO:2001244) Pre-MiRNA Processing (GO:0031054) Protein Phosphorylation (GO:0006468) Protein Stabilization (GO:0050821) Regulation Of Production Of Small RNA Involved In Gene Silencing By RNA (GO:0070920) SiRNA Processing (GO:0030422) Skeletal System Morphogenesis (GO:0048705)
Molecular Function	Double-Stranded RNA Binding (GO:0003725) Enzyme Activator Activity (GO:0008047) Enzyme Binding (GO:0019899) Pre-MiRNA Binding (GO:0070883) Protein Homodimerization Activity (GO:0042803) SiRNA Binding (GO:0035197)

This website uses cookies to improve user experience. By using NucEnvDB you consent to all cookies in accordance with our privacy policy. OK