NucEnvDB

NucEnvDB

A database of Nuclear Envelope Proteins and their Interactions

RISC-loading complex subunit TARBP2 - Rattus norvegicus - NucEnvDB

RISC-loading complex subunit TARBP2 (Rattus norvegicus)

FASTA TEXT XML

Subcellular Location Biology & Function Cross-References

General Information

Protein Information
Protein Name	RISC-loading complex subunit TARBP2
Accession Code	Q3SWU0
Gene	Tarbp2
Organism	Rattus norvegicus \| Norway rat (Taxonomy: 10116)
Part of Reference Proteome?	Yes
Sequence (Length: 365)
MSEEDQGSGSTTGCGLPSIEQMLAANPGKTPISLLQEYGTRIGKTPVYDLLKAEGQAHQPNFTFRVTVGDTSCTGQGPSKKAAKHKAAEVALKHLKGGSMLEPALEDSSSFSLLDSSVPEDTAVIAAEAA APVPSALLTRSPPMEMQPPVSPQQSECNPVGALQELVVQKGWRLPEYMVTQESGPAHRKEFTMTCRVERFIEIGSGTSKKLAKRNAAAKMLLRVHTVPLDARDGNEAEPDDDHFSIGVSSRLDGLRNRGP GCTWDSLRNSVGEKILSLRNCSVGSLGSLGSACCSILSELSAEQAFHVSYLDIEELSLSGLCQCLVELSTQPATVCYGSATTREAARGDAARRALQYLRIMAGSK

Subcellular Location

Description
Cytoplasm {Sequence AnalysisHAMAP-Rule:MF_03034}. Cytoplasm, perinuclear region {Sequence AnalysisHAMAP-Rule:MF_03034}. Nucleus {Sequence AnalysisHAMAP-Rule:MF_03034}.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Unknown	UniProt	Sequence Analysis
Assigned Ontology terms

Cellular Component	Cytoplasm (GO:0005737) Nuclear Body (GO:0016604) Nucleus (GO:0005634) Perinuclear Region Of Cytoplasm (GO:0048471) RISC Complex (GO:0016442) RISC-Loading Complex (GO:0070578)

Biology & Function

Description
Required for formation of the RNA induced silencing complex (RISC). Component of the RISC loading complex (RLC), also known as the micro-RNA (miRNA) loading complex (miRLC), which is composed of DICER1, AGO2 and TARBP2. Within the RLC/miRLC, DICER1 and TARBP2 are required to process precursor miRNAs (pre-miRNAs) to mature miRNAs and then load them onto AGO2. AGO2 bound to the mature miRNA constitutes the minimal RISC and may subsequently dissociate from DICER1 and TARBP2. May also play a role in the production of short interfering RNAs (siRNAs) from double-stranded RNA (dsRNA) by DICER1. {Sequence AnalysisHAMAP- Rule:MF_03034}.
Assigned Ontology terms

Biological Process	Global Gene Silencing By MRNA Cleavage (GO:0098795) MiRNA Processing (GO:0035196) Multicellular Organism Growth (GO:0035264) Negative Regulation Of Defense Response To Virus By Host (GO:0050689) Neural Precursor Cell Proliferation (GO:0061351) Positive Regulation Of Muscle Cell Differentiation (GO:0051149) Positive Regulation Of Translation (GO:0045727) Positive Regulation Of Viral Genome Replication (GO:0045070) Pre-MiRNA Processing (GO:0031054) Regulation Of MiRNA Maturation (GO:1903798) Regulation Of Production Of Small RNA Involved In Gene Silencing By RNA (GO:0070920) Regulation Of SiRNA Production (GO:0070921) Regulation Of Viral Transcription (GO:0046782) RISC Complex Assembly (GO:0070922) Single Fertilization (GO:0007338) SiRNA Processing (GO:0030422) Skeletal Muscle Tissue Regeneration (GO:0043403) Spermatid Development (GO:0007286)
Molecular Function	Double-Stranded RNA Binding (GO:0003725) Enzyme Binding (GO:0019899) Identical Protein Binding (GO:0042802) MiRNA Binding (GO:0035198) Pre-MiRNA Binding (GO:0070883) Protein Homodimerization Activity (GO:0042803) Protein N-Terminus Binding (GO:0047485) SiRNA Binding (GO:0035197)

Cross-References

Database	Links
UNIPROT	Q3SWU0
Pfam	PF00035
PROSITE	PS50137

Powered by W3.css | Privacy Notice

x

This website uses cookies to improve user experience. By using NucEnvDB you consent to all cookies in accordance with our privacy policy. OK