NucEnvDB

NucEnvDB

A database of Nuclear Envelope Proteins and their Interactions

Lamina-associated polypeptide 2, isoforms beta/delta/epsilon/gamma - Mus musculus - NucEnvDB

Lamina-associated polypeptide 2, isoforms beta/delta/epsilon/gamma (Mus musculus)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	Lamina-associated polypeptide 2, isoforms beta/delta/epsilon/gamma
Accession Code	Q61029
Gene	Tmpo
Organism	Mus musculus \| House mouse (Taxonomy: 10090)
Part of Reference Proteome?	Yes
Sequence (Length: 452)
MPEFLEDPSVLTKDKLKSELVANNVTLPAGEQRKDVYVQLYLQHLTARNRPPLAAGANSKGPPDFSSDEEREPTPVLGSGASVGRGRGAVGRKATKKTDKPRLEDKDDLDVTELSNEELLDQLVRYGVNP GPIVGTTRKLYEKKLLKLREQGTESRSSTPLPTVSSSAENTRQNGSNDSDRYSDNDEDSKIELKLEKREPLKGRAKTPVTLKQRRTEHNQSYSQAGVTETEWTSGSSTGGPLQALTRESTRGSRRTPRKR VETSQHFRIDGAVISESTPIAETIKASSNESLVANRLTGNFKHASSILPITEFSDITRRTPKKPLTRAEVGEKTEERRVDRDILKEMFPYEASTPTGISASCRRPIKGAAGRPLELSDFRMEESFSSKYV PKYAPLADVKSEKTKKRRSVPMWIKMLLFALVAVFLFLVYQAMETNQGNPFTNFLQDTKISN

Subcellular Location

Description
Nucleus inner membrane {By Similarity}; Single-pass type II membrane protein {By Similarity}. Chromosome {By Similarity}. Note=Tightly associated with the nuclear lamina. {By Similarity}.
Position in the Nuclear Envelope
Location	Location ID	Description
Nuclear Envelope	SL-0178	The nuclear envelope is a membrane system which surrounds the nucleoplasm of eukaryotic cells. It is composed of the nuclear lamina, nuclear pore complexes and two nuclear membranes. The space between the two membranes is called the nuclear intermembrane space.
Nuclear Inner Membrane	SL-0179	The inner membrane of the nucleus is the membrane which separates the nuclear matrix from the intermembrane space. In mammals, the inner nuclear membrane is associated with heterochromatin and the nuclear lamina.
Nuclear Membrane	SL-0182	The membrane surrounding the nucleus. This term is used when it is not known if the protein is found in or associated with the inner or outer nuclear membrane.
Membrane Topology
Topology	Source	Annotation Type
Transmembrane	UniProt	Sequence Analysis {ECO:0000255}
Assigned Ontology terms

Cellular Component	Chromatin (GO:0000785) Nuclear Envelope (GO:0005635) Nuclear Inner Membrane (GO:0005637) Nuclear Membrane (GO:0031965) Nucleus (GO:0005634)

Biology & Function

Description
May help direct the assembly of the nuclear lamina and thereby help maintain the structural organization of the nuclear envelope. Possible receptor for attachment of lamin filaments to the inner nuclear membrane. May be involved in the control of initiation of DNA replication through its interaction with NAKAP95 (By similarity). {By Similarity}.
Assigned Ontology terms

Biological Process	Regulation Of DNA-Templated Transcription (GO:0006355)
Molecular Function	DNA Binding (GO:0003677)

Protein-Protein Interactions

Interactions with other proteins (4 interactors)

Partner (UniProt)		IntAct	Confidence score
Q64321	Zinc finger and BTB domain-containing protein 7B (Krueppel-related zinc finger protein cKrox) (c-Krox) (T-helper-inducing POZ/Krueppel-like factor) (Zinc finger protein 67) (Zfp-67) (Zinc finger protein Th-POK)	EBI-6172093	0.50
O88895	Histone deacetylase 3 (HD3) (EC 3.5.1.98) (Protein deacetylase HDAC3) (EC 3.5.1.-) (Protein deacylase HDAC3) (EC 3.5.1.-)	EBI-6172144	0.35
O88609	LIM homeobox transcription factor 1-beta (LIM/homeobox protein 1.2) (LMX-1.2) (LIM/homeobox protein LMX1B)	EBI-13951426	0.35
P70326	T-box transcription factor TBX5 (T-box protein 5)	EBI-16360068	0.35

Cross-References

Database	Links
UNIPROT	Q61029 Q3UCI5 Q61030 Q61031 Q61032
Pfam	PF03020 PF08198
PROSITE	PS50954 PS50955

Powered by W3.css | Privacy Notice

x

This website uses cookies to improve user experience. By using NucEnvDB you consent to all cookies in accordance with our privacy policy. OK