NucEnvDB

NucEnvDB

A database of Nuclear Envelope Proteins and their Interactions

Ras-related protein Rab-7L1 - Rattus norvegicus - NucEnvDB

Ras-related protein Rab-7L1 (Rattus norvegicus)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	Ras-related protein Rab-7L1
Accession Code	Q63481
Gene	Rab29
Organism	Rattus norvegicus \| Norway rat (Taxonomy: 10116)
Part of Reference Proteome?	Yes
Sequence (Length: 204)
MGSRDHLFKVLVVGDAAVGKTSLVQRYSQDSFSKHYKSTVGVDFALKVLQWSDSEMVRLQLWDIAGQERFTSMTRLYYRDASACVIMFDVTNATTFSNSQRWKQDLDSKLTLPSGEPVPCLLLANKSDLS PWAVSRDQIDRFSKENGFTGWTETSVKENKNINEAMRVLVEKMMNNSREDIMSSSTQGNYINLQTKPSPGWTCC

Subcellular Location

Description
Cell membrane {Curator Inference}; Lipid-anchor {Curator Inference}; Cytoplasmic side {Curator Inference}. Cytoplasm {ECO:0000250\|UniProtKB:O14966}. Cytoplasm, perinuclear region {ECO:0000250\|UniProtKB:O14966}. Golgi apparatus {ECO:0000269\|PubMed:23395371}. Golgi apparatus, trans-Golgi network {ECO:0000250\|UniProtKB:O14966}. Cytoplasm, cytoskeleton {ECO:0000269\|PubMed:23395371}. Note=Colocalizes with GM130 at the Golgi apparatus (By similarity). Colocalizes with dynamic tubules emerging from and retracting to the Golgi apparatus (By similarity). Colocalizes with TGN46 at the trans-Golgi network (TGN) (By similarity). Colocalized with LRRK2 along tubular structures emerging from Golgi apparatus (PubMed:23395371). {ECO:0000250\|UniProtKB:O14966, ECO:0000269\|PubMed:23395371}.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Lipid-Anchored	UniProt	By Similarity {ECO:0000250}
Assigned Ontology terms

Cellular Component	Cis-Golgi Network (GO:0005801) Cytoplasm (GO:0005737) Cytoskeleton (GO:0005856) Cytosol (GO:0005829) Early Endosome (GO:0005769) Golgi Apparatus (GO:0005794) Intracellular Vesicle (GO:0097708) Melanosome (GO:0042470) Mitochondrion (GO:0005739) Perinuclear Region Of Cytoplasm (GO:0048471) Plasma Membrane (GO:0005886) Recycling Endosome (GO:0055037) Trans-Golgi Network (GO:0005802) Vacuole (GO:0005773) Vesicle (GO:0031982)

Biology & Function

Description
The small GTPases Rab are key regulators in vesicle trafficking (PubMed:23395371). Essential for maintaining the integrity of endosome-trans-Golgi network structure (PubMed:23395371). Together with LRRK2, plays a role in the retrograde trafficking pathway for recycling proteins, such as mannose 6 phosphate receptor (M6PR), between lysosomes and the Golgi apparatus in a retromer-dependent manner (PubMed:23395371). Recruits LRRK2 to the Golgi apparatus and stimulates LRRK2 kinase activity (By similarity). Regulates also neuronal process morphology in the intact central nervous system (CNS) (PubMed:23395371). {By SimilarityUniProtKB:O14966, Experimental EvidencePubMed:23395371}.
Assigned Ontology terms

Biological Process	Cell Differentiation (GO:0030154) Cilium Assembly (GO:0060271) Golgi Organization (GO:0007030) Intracellular Protein Transport (GO:0006886) Melanosome Organization (GO:0032438) Mitochondrion Organization (GO:0007005) Modulation By Host Of Viral Process (GO:0044788) Negative Regulation Of Neuron Projection Development (GO:0010977) Positive Regulation Of Intracellular Protein Transport (GO:0090316) Positive Regulation Of Receptor Recycling (GO:0001921) Positive Regulation Of T Cell Receptor Signaling Pathway (GO:0050862) Protein Localization To Ciliary Membrane (GO:1903441) Protein Localization To Membrane (GO:0072657) Regulation Of Neuron Death (GO:1901214) Regulation Of Retrograde Transport, Endosome To Golgi (GO:1905279) Response To Bacterium (GO:0009617) Retrograde Transport, Endosome To Golgi (GO:0042147) Synapse Assembly (GO:0007416) T Cell Activation (GO:0042110) Toxin Transport (GO:1901998) Viral RNA Genome Replication (GO:0039694)
Molecular Function	Dynein Complex Binding (GO:0070840) GDP Binding (GO:0019003) GTP Binding (GO:0005525) GTPase Activity (GO:0003924) Kinesin Binding (GO:0019894) Small GTPase Binding (GO:0031267)

Protein-Protein Interactions

Interactions with other proteins (2 interactors)

Partner (UniProt)		IntAct	Confidence score
Q5S007	Leucine-rich repeat serine/threonine-protein kinase 2 (EC 2.7.11.1) (EC 3.6.5.-) (Dardarin)	EBI-6514548	0.46
Q08484	GTPase-activating protein GYP1 (GAP for YPT1)	EBI-15592913	0.44

Cross-References

Database	Links
UNIPROT	Q63481
Pfam	PF00071
PROSITE	PS51419

Powered by W3.css | Privacy Notice

x

This website uses cookies to improve user experience. By using NucEnvDB you consent to all cookies in accordance with our privacy policy. OK