Serine/threonine-protein kinase tousled-like 2 - Homo sapiens

Serine/threonine-protein kinase tousled-like 2 (Homo sapiens)

FASTA TEXT XML

Subcellular Location Biology & Function Disease Associations Interactions Cross-References

General Information

Protein Information
Protein Name	Serine/threonine-protein kinase tousled-like 2
Accession Code	Q86UE8
Gene	TLK2
Organism	Homo sapiens \| Human (Taxonomy: 9606)
Part of Reference Proteome?	Yes
Sequence (Length: 772)
MMEELHSLDPRRQELLEARFTGVGVSKGPLNSESSNQSLCSVGSLSDKEVETPEKKQNDQRNRKRKAEPYETSQGKGTPR GHKISDYFEFAGGSAPGTSPGRSVPPVARSSPQHSLSNPLPRRVEQPLYGLDGSAAKEATEEQSALPTLMSVMLAKPRLD TEQLAQRGAGLCFTFVSAQQNSPSSTGSGNTEHSCSSQKQISIQHRQTQSDLTIEKISALENSKNSDLEKKEGRIDDLLR ANCDLRRQIDEQQKMLEKYKERLNRCVTMSKKLLIEKSKQEKMACRDKSMQDRLRLGHFTTVRHGASFTEQWTDGYAFQN LIKQQERINSQREEIERQRKMLAKRKPPAMGQAPPATNEQKQRKSKTNGAENETPSSGNTELKDTAPALGAHSLLRLTLA EYHEQEEIFKLRLGHLKKEEAEIQAELERLERVRNLHIRELKRIHNEDNSQFKDHPTLNDRYLLLHLLGRGGFSEVYKAF DLTEQRYVAVKIHQLNKNWRDEKKENYHKHACREYRIHKELDHPRIVKLYDYFSLDTDSFCTVLEYCEGNDLDFYLKQHK LMSEKEARSIIMQIVNALKYLNEIKPPIIHYDLKPGNILLVNGTACGEIKITDFGLSKIMDDDSYNSVDGMELTSQGAGT YWYLPPECFVVGKEPPKISNKVDVWSVGVIFYQCLYGRKPFGHNQSQQDILQENTILKATEVQFPPKPVVTPEAKAFIRR CLAYRKEDRIDVQQLACDPYLLPHIRKSVSTSSPAGAAIASTSGASNNSSSN

Structure Viewer (PDB: 5O0Y)

Subcellular Location

Description
Nucleus. Cytoplasm, perinuclear region. Cytoplasm, cytoskeleton. Note=Colocalizes with the cytoplasmic intermediate filament system during the G1 phase of the cell cycle. Present in the perinuclear region at S phase and in the nucleus at late G2.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Unknown	UniProt	Sequence Analysis
Assigned Ontology terms

Cellular Component	Intermediate Filament (GO:0005882) Nucleus (GO:0005634) Perinuclear Region Of Cytoplasm (GO:0048471)

Biology & Function

Description
Serine/threonine-protein kinase involved in the process of chromatin assembly and probably also DNA replication, transcription, repair, and chromosome segregation. Phosphorylates the chromatin assembly factors ASF1A and ASF1B. Phosphorylation of ASF1A prevents its proteasome-mediated degradation, thereby enhancing chromatin assembly. Negative regulator of amino acid starvation-induced autophagy. {Experimental EvidencePubMed:10523312, Experimental EvidencePubMed:11470414, Experimental EvidencePubMed:12660173, Experimental EvidencePubMed:12955071, Experimental EvidencePubMed:20016786, Experimental EvidencePubMed:22354037, Experimental EvidencePubMed:9427565}.
Assigned Ontology terms

Biological Process	Cell Cycle (GO:0007049) Cellular Response To DNA Damage Stimulus (GO:0006974) Cellular Response To Gamma Radiation (GO:0071480) Chromatin Organization (GO:0006325) Chromosome Segregation (GO:0007059) Intracellular Signal Transduction (GO:0035556) Localization (GO:0051179) Negative Regulation Of Autophagy (GO:0010507) Negative Regulation Of Proteasomal Ubiquitin-Dependent Protein Catabolic Process (GO:0032435) Peptidyl-Serine Phosphorylation (GO:0018105) Protein Phosphorylation (GO:0006468) Regulation Of Chromatin Organization (GO:1902275)
Molecular Function	ATP Binding (GO:0005524) Identical Protein Binding (GO:0042802) Protein Serine Kinase Activity (GO:0106310) Protein Serine/Threonine Kinase Activity (GO:0004674)

Disease associations

Description
Intellectual developmental disorder, autosomal dominant 57 (MRD57) [MIM:618050]: A disorder characterized by significantly below average general intellectual functioning associated with impairments in adaptive behavior and manifested during the developmental period. MRD57 is characterized by delayed psychomotor development apparent in infancy or early childhood, and a variety of behavioral abnormalities. Affected individuals may have severe gastro-intestinal problems, and facial dysmorphism. {Experimental EvidencePubMed:27479843, Experimental EvidencePubMed:29861108}. Note=The disease is caused by variants affecting the gene represented in this entry.
Database Associations
OMIM	608439 618050
DisGeNET	11011

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (2 interactors)

Partner (NucEnvDB)		IntAct	Confidence score
Q86UE8	Self	EBI-24307235	0.56
Q0D2I5	Non-homologous end joining factor IFFO1	EBI-11911984	0.00
Interactions with other proteins (36 interactors)

Partner (UniProt)		IntAct	Confidence score
Q9NVP2	Histone chaperone ASF1B (Anti-silencing function protein 1 homolog B) (hAsf1) (hAsf1b) (CCG1-interacting factor A-II) (CIA-II) (hCIA-II)	EBI-25476220	0.56
Q15306	Interferon regulatory factor 4 (IRF-4) (Lymphocyte-specific interferon regulatory factor) (LSIRF) (Multiple myeloma oncogene 1) (NF-EM5)	EBI-6115566	0.50
Q92985	Interferon regulatory factor 7 (IRF-7)	EBI-6115673	0.50
Q15418	Ribosomal protein S6 kinase alpha-1 (S6K-alpha-1) (EC 2.7.11.1) (90 kDa ribosomal protein S6 kinase 1) (p90-RSK 1) (p90RSK1) (p90S6K) (MAP kinase-activated protein kinase 1a) (MAPK-activated protein kinase 1a) (MAPKAP kinase 1a) (MAPKAPK-1a) (Ribosomal S6 kinase 1) (RSK-1)	EBI-6256547	0.35
E9Q4K7	Kinesin family member 13B	EBI-11042417	0.35
P63167	Dynein light chain 1, cytoplasmic (8 kDa dynein light chain) (DLC8) (Dynein light chain LC8-type 1) (Protein inhibitor of neuronal nitric oxide synthase) (PIN)	EBI-12449761	0.64
P56726	Smoothened homolog (SMO)	EBI-11127526	0.35
Q9Y294	Histone chaperone ASF1A (Anti-silencing function protein 1 homolog A) (hAsf1) (hAsf1a) (CCG1-interacting factor A) (CIA) (hCIA)	EBI-11137466	0.53
Q96FJ2	Dynein light chain 2, cytoplasmic (8 kDa dynein light chain b) (DLC8b) (Dynein light chain LC8-type 2)	EBI-12449804	0.64
P26367	Paired box protein Pax-6 (Aniridia type II protein) (Oculorhombin)	EBI-24282100	0.56
Q8NHQ1	Centrosomal protein of 70 kDa (Cep70) (p10-binding protein)	EBI-24339490	0.56
Q96IK5	Germ cell-less protein-like 1 (Spermatogenesis-associated protein 29)	EBI-24367628	0.56
Q96NE9	FERM domain-containing protein 6 (Willin)	EBI-23847597	0.56
Q02548	Paired box protein Pax-5 (B-cell-specific transcription factor) (BSAP)	EBI-24416001	0.56
Q9NPF5	DNA methyltransferase 1-associated protein 1 (DNMAP1) (DNMT1-associated protein 1)	EBI-25206676	0.56
Q7KZS0	Ubiquitin-conjugating enzyme E2I (UBC9 homolog, yeast) (Ubiquitin-conjugating enzyme E2I (UBC9 homolog, yeast), isoform CRA_b)	EBI-25226009	0.56
Q53SF7	Cordon-bleu protein-like 1	EBI-11916124	0.00
Q8IY63	Angiomotin-like protein 1	EBI-11921650	0.00
Q9BWV3	Cytidine and dCMP deaminase domain-containing protein 1 (EC 3.5.4.5) (Cytidine deaminase) (Testis development protein NYD-SP15)	EBI-11930524	0.00
Q9UN30	Sex comb on midleg-like protein 1	EBI-11939262	0.00
Q9UPM6	LIM/homeobox protein Lhx6 (LIM homeobox protein 6) (LIM/homeobox protein Lhx6.1)	EBI-21621887	0.35
Q5VX52	Spermatogenesis-associated protein 1 (Sperm-specific protein SP-2)	EBI-21635815	0.35
Q8N140	EP300-interacting inhibitor of differentiation 3 (EID-3) (E1A-like inhibitor of differentiation 3) (EID-1-like inhibitor of differentiation 3) (Non-structural maintenance of chromosomes element 4 homolog B) (NS4EB) (Non-SMC element 4 homolog B)	EBI-21773860	0.35
Q9UHA7	Interleukin-36 alpha (FIL1 epsilon) (Interleukin-1 epsilon) (IL-1 epsilon) (Interleukin-1 family member 6) (IL-1F6)	EBI-21786920	0.35
O75679	Ret finger protein-like 3	EBI-21798659	0.35
Q9Y6J0	Calcineurin-binding protein cabin-1 (Calcineurin inhibitor) (CAIN)	EBI-21877366	0.35
Q9UKI8	Serine/threonine-protein kinase tousled-like 1 (EC 2.7.11.1) (PKU-beta) (Tousled-like kinase 1)	EBI-21877366	0.35
P62979	Ubiquitin-40S ribosomal protein S27a (Ubiquitin carboxyl extension protein 80) [Cleaved into: Ubiquitin; 40S ribosomal protein S27a (Small ribosomal subunit protein eS31)]	EBI-21877366	0.35
P27361	Mitogen-activated protein kinase 3 (MAP kinase 3) (MAPK 3) (EC 2.7.11.24) (ERT2) (Extracellular signal-regulated kinase 1) (ERK-1) (Insulin-stimulated MAP2 kinase) (MAP kinase isoform p44) (p44-MAPK) (Microtubule-associated protein 2 kinase) (p44-ERK1)	EBI-28934804	0.35
Q96IU4	Putative protein-lysine deacylase ABHD14B (EC 2.3.1.-) (Alpha/beta hydrolase domain-containing protein 14B) (Abhydrolase domain-containing protein 14B) (CCG1-interacting factor B)	EBI-28942113	0.35
Q96FZ7	Charged multivesicular body protein 6 (Chromatin-modifying protein 6) (Vacuolar protein sorting-associated protein 20) (Vps20) (hVps20)	EBI-28942113	0.35
Q5T3J3	Ligand-dependent nuclear receptor-interacting factor 1 (HP1-binding protein enriched in inactive X chromosome protein 1) (HBiX1) (Receptor-interacting factor 1)	EBI-28942113	0.35
P49458	Signal recognition particle 9 kDa protein (SRP9)	EBI-28942113	0.35
P25205	DNA replication licensing factor MCM3 (EC 3.6.4.12) (DNA polymerase alpha holoenzyme-associated protein P1) (P1-MCM3) (RLF subunit beta) (p102)	EBI-28942113	0.35
P12004	Proliferating cell nuclear antigen (PCNA) (Cyclin)	EBI-28942113	0.35
Q13257	Mitotic spindle assembly checkpoint protein MAD2A (HsMAD2) (Mitotic arrest deficient 2-like protein 1) (MAD2-like protein 1)	EBI-30825948	0.44

Cross-References

Database	Links
UNIPROT	Q86UE8 D3DU07 Q9UKI7 Q9Y4F7
PDB	5O0Y 7LO0
Pfam	PF00069
PROSITE	PS00107 PS50011 PS00108
OMIM	608439 618050
DisGeNET	11011

Serine/threonine-protein kinase tousled-like 2 (Homo sapiens)

General Information

Protein Information

Structure Viewer (PDB: 5O0Y)

Subcellular Location

Description Show

Position in the Nuclear Envelope

Membrane Topology

Assigned Ontology terms

Biology & Function

Description Hide

Assigned Ontology terms

Disease associations

Description

Database Associations

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (2 interactors)

Interactions with other proteins (36 interactors)

Cross-References

Database

Links

Description

Description