NucEnvDB

NucEnvDB

A database of Nuclear Envelope Proteins and their Interactions

Optineurin - Mus musculus - NucEnvDB

Optineurin (Mus musculus)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	Optineurin
Accession Code	Q8K3K8
Gene	Optn
Organism	Mus musculus \| House mouse (Taxonomy: 10090)
Part of Reference Proteome?	Yes
Sequence (Length: 584)
MSHQPLSCLTEKGDSPCETPGNGPSNMVHPSLDTFTPEELLQQMKELLVENHQLKEAMKLNNQAMKGRFEELSAWTEKQK EERLLFEMQSKEVKERLKALTHENERLKEELGKFKEKSEKPLEDLTGGYRYPRALEEEVEKLKTQVEQEVEHLKIQVMRL RAEKADLLGIVSELQLKLNSGGSSEDSFVEIRMTEGETEGAMKEMKNCPTPTRTDPISLSNCTEDARSCAEFEELTVSQL LLCLREGNQKVERLEVALREAKERISDFEKKANGHSSTEKQTARRADREKEDKGQESVGSEVETLSIQVTSLFKELQEAH TKLSEAELMKKRLQEKCQALERKNSATPSELNEKQELVYSNKKLELQVESMRSEIKMEQAKTEEEKSRLATLQATHNKLL QEHNKALKTIEELTKQQAEKVDKMLLQELSEKLELAEQALASKQLQMDEMKQTLAKQEEDLETMAVLRAQMEVYCSDFHA ERAAREKIHEEKEQLALQLAILLKENNDIEEGGSRQSLMEMQCRHGARTSDSDQQTYLFQRGAEDRSWQHGQQPRSIPIH SCPKCGEVLPDIDTLQIHVMDCII

Structure Viewer (PDB: 5WQ4)

Subcellular Location

Description
Cytoplasm, perinuclear region {Experimental EvidencePubMed:15607428}. Golgi apparatus {By SimilarityUniProtKB:Q96CV9}. Golgi apparatus, trans-Golgi network {By Similarity}. Cytoplasmic vesicle, autophagosome {By Similarity}. Cytoplasmic vesicle {By Similarity}. Recycling endosome {By Similarity}. Note=Found in the perinuclear region and associates with the Golgi apparatus. Colocalizes with MYO6 and RAB8 at the Golgi complex and in vesicular structures close to the plasma membrane. Localizes to LC3- positive cytoplasmic vesicles upon induction of autophagy (By similarity). {By Similarity, By SimilarityUniProtKB:Q96CV9}.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Unknown	UniProt	Sequence Analysis
Assigned Ontology terms

Cellular Component	Autophagosome (GO:0005776) Axon (GO:0030424) Cytoplasm (GO:0005737) Cytoplasmic Vesicle (GO:0031410) Cytosol (GO:0005829) Golgi Apparatus (GO:0005794) Neuronal Cell Body (GO:0043025) Nucleus (GO:0005634) Perinuclear Region Of Cytoplasm (GO:0048471) Recycling Endosome (GO:0055037) Trans-Golgi Network (GO:0005802)

Biology & Function

Description
Plays an important role in the maintenance of the Golgi complex, in membrane trafficking, in exocytosis, through its interaction with myosin VI and Rab8. Links myosin VI to the Golgi complex and plays an important role in Golgi ribbon formation. Plays a role in the activation of innate immune response during viral infection. Mechanistically, recruits TBK1 at the Golgi apparatus, promoting its trans-phosphorylation after RLR or TLR3 stimulation. In turn, activated TBK1 phosphorylates its downstream partner IRF3 to produce IFN-beta. Plays a neuroprotective role in the eye and optic nerve. May act by regulating membrane trafficking and cellular morphogenesis via a complex that contains Rab8 and hungtingtin (HD). Mediates the interaction of Rab8 with the probable GTPase-activating protein TBC1D17 during Rab8-mediated endocytic trafficking, such as of transferrin receptor (TFRC/TfR); regulates Rab8 recruitnment to tubules emanating from the endocytic recycling compartment. Autophagy receptor that interacts directly with both the cargo to become degraded and an autophagy modifier of the MAP1 LC3 family; targets ubiquitin-coated bacteria (xenophagy), such as cytoplasmic Salmonella enterica, and appears to function in the same pathway as SQSTM1 and CALCOCO2/NDP52. {By SimilarityUniProtKB:Q96CV9, Experimental EvidencePubMed:26677802}.
Assigned Ontology terms

Biological Process	Autophagy (GO:0006914) Cellular Response To Unfolded Protein (GO:0034620) Defense Response To Gram-Negative Bacterium (GO:0050829) Golgi Organization (GO:0007030) Golgi Ribbon Formation (GO:0090161) Golgi To Plasma Membrane Protein Transport (GO:0043001) Innate Immune Response (GO:0045087) Negative Regulation Of Cell Population Proliferation (GO:0008285) Negative Regulation Of I-KappaB Kinase/NF-KappaB Signaling (GO:0043124) Negative Regulation Of Neuron Apoptotic Process (GO:0043524) Negative Regulation Of Receptor Recycling (GO:0001920) Parkin-Mediated Stimulation Of Mitophagy In Response To Mitochondrial Depolarization (GO:0061734) Positive Regulation Of Autophagy (GO:0010508) Positive Regulation Of Cell Population Proliferation (GO:0008284) Positive Regulation Of Cytokine Production (GO:0001819) Positive Regulation Of Gene Expression (GO:0010628) Positive Regulation Of Neural Precursor Cell Proliferation (GO:2000179) Positive Regulation Of Neuron Apoptotic Process (GO:0043525) Positive Regulation Of Xenophagy (GO:1904417) Protein Localization (GO:0008104) Protein Localization To Golgi Apparatus (GO:0034067) Regulation Of I-KappaB Kinase/NF-KappaB Signaling (GO:0043122)
Molecular Function	Identical Protein Binding (GO:0042802) K63-Linked Polyubiquitin Modification-Dependent Protein Binding (GO:0070530) Metal Ion Binding (GO:0046872) Polyubiquitin Modification-Dependent Protein Binding (GO:0031593) Protein C-Terminus Binding (GO:0008022) Protein-Macromolecule Adaptor Activity (GO:0030674) Small GTPase Binding (GO:0031267) TFIIIA-Class Transcription Factor Binding (GO:0001155) Ubiquitin Binding (GO:0043130)

Protein-Protein Interactions

Interactions with other proteins (3 interactors)

Partner (UniProt)		IntAct	Confidence score
Q3U0D9	E3 ubiquitin-protein ligase HACE1 (EC 2.3.2.26) (HECT domain and ankyrin repeat-containing E3 ubiquitin-protein ligase 1) (HECT-type E3 ubiquitin transferase HACE1)	EBI-9683581	0.35
Q64337	Sequestosome-1 (STONE14) (Ubiquitin-binding protein p62)	EBI-9683581	0.35
Q9WUN2	Serine/threonine-protein kinase TBK1 (EC 2.7.11.1) (T2K) (TANK-binding kinase 1)	EBI-12521947	0.40

Cross-References

Database	Links
UNIPROT	Q8K3K8 A2ASP3
PDB	5WQ4
Pfam	PF16516 PF11577
PROSITE	PS51801

Powered by W3.css | Privacy Notice

x

This website uses cookies to improve user experience. By using NucEnvDB you consent to all cookies in accordance with our privacy policy. OK