Protein Information | 
			|
|---|---|
| Protein Name | Protein KASH5 | 
| Accession Code | Q8N6L0 | 
| Gene | KASH5 | 
| Organism | Homo sapiens | Human (Taxonomy: 9606) | 
| Part of Reference Proteome? | Yes | 
| Sequence (Length: 562) | |
| 
				MDLPEGPVGGPTAEMYLRERPEEARLGMPVSLEEQILNSTFEACDPQRTGTVAVAQVLAYLEAVTGQGPQDARLQTLANS LDPNGEGPKATVDLDTFLVVMRDWIAACQLHGGLELEEETAFQGALTSRQLPSGCPEAEEPANLESFGGEDPRPELQATA DLLSSLEDLELSNRRLVGENAKLQRSMETAEEGSARLGEEILALRKQLHSTQQALQFAKAMDEELEDLKTLARSLEEQNR SLLAQARQAEKEQQHLVAEMETLQEENGKLLAERDGVKKRSQELAMEKDTLKRQLFECEHLICQRDTILSERTRDVESLA QTLEEYRVTTQELRLEISRLEEQLSQTYEGPDELPEGAQLRRVGWTELLPPSLGLEIEAIRQKQEVATADLSNPLCGVWQ WEEVIHETSEETEFPSEAPAGGQRNFQGEPAHPEEGRKEPSMWLTRREEEEDAESQVTADLPVPLGAPRPGDIPENPPER PARRELQQALVPVMKKLVPVRRRAWGQLCLPPQRLRVTRHPLIPAPVLGLLLLLLLSVLLLGPSPPPTWPHLQLCYLQPP PV  | 
			|
Structure Viewer (PDB: 6R2I) | 
|---|
Description | 
||
|---|---|---|
| Nucleus outer membrane {By SimilarityUniProtKB:Q80VJ8, Curator Inference}; Single-pass type IV membrane protein {Curator Inference}; Cytoplasmic side {Curator Inference}. Nucleus {By SimilarityUniProtKB:Q80VJ8}. Chromosome, telomere {By SimilarityUniProtKB:Q80VJ8}. Note=Localized exclusively at telomeres from the leptotene to diplotene stages. Colocalizes with SUN2 at sites of telomere attachment in meiocytes. At oocyte MI stage localized around the spindle, at MII stage localized to the spindle poles. {By SimilarityUniProtKB:Q80VJ8}. | Position in the Nuclear Envelope | 
|
| Location | Location ID | Description | 
| Nuclear Envelope | SL-0178 | The nuclear envelope is a membrane system which surrounds the nucleoplasm of eukaryotic cells. It is composed of the nuclear lamina, nuclear pore complexes and two nuclear membranes. The space between the two membranes is called the nuclear intermembrane space. | 
| Nuclear Membrane | SL-0182 | The membrane surrounding the nucleus. This term is used when it is not known if the protein is found in or associated with the inner or outer nuclear membrane. | 
| Nuclear Outer Membrane | SL-0183 | The outer membrane of the nucleus is the membrane facing the cytoplasm. In mammals, the outer nuclear membrane is continuous in many places with the rough endoplasmic reticulum and is dotted with ribosomes. | Membrane Topology | 
| Topology | Source | Annotation Type | 
| Transmembrane | UniProt | Sequence Analysis {ECO:0000255} | Assigned Ontology terms | 
| Cellular Component | Chromosome, Telomeric Region (GO:0000781) Lateral Element (GO:0000800) Meiotic Nuclear Membrane Microtubule Tethering Complex (GO:0034993) Meiotic Spindle Pole (GO:0090619) Nuclear Outer Membrane (GO:0005640)  | 
|
Description | 
		|
|---|---|
| As a component of the LINC (LInker of Nucleoskeleton and Cytoskeleton) complex, involved in the connection between the nuclear lamina and the cytoskeleton. The nucleocytoplasmic interactions established by the LINC complex play an important role in the transmission of mechanical forces across the nuclear envelope and in nuclear movement and positioning. Required for telomere attachment to nuclear envelope in the prophase of meiosis and for rapid telomere prophase movements implicating a SUN1/2:KASH5 LINC complex in which SUN1 and SUN2 seem to act at least partial redundantly. Required for homolog pairing during meiotic prophase in spermatocytes and probably oocytes. Essential for male and female gametogenesis. Recruits cytoplasmic dynein to telomere attachment sites at the nuclear envelope in spermatocytes. In oocytes is involved in meiotic resumption and spindle formation. {By SimilarityUniProtKB:Q80VJ8}. | Assigned Ontology terms | 
                
| Biological Process | Actin Filament Organization (GO:0007015) Chromosome Localization To Nuclear Envelope Involved In Homologous Chromosome Segregation (GO:0090220) Double-Strand Break Repair Via Homologous Recombination (GO:0000724) Homologous Chromosome Pairing At Meiosis (GO:0007129) Microtubule Cytoskeleton Organization Involved In Homologous Chromosome Segregation (GO:0090172) Oogenesis (GO:0048477) Spermatogenesis (GO:0007283) Spindle Assembly (GO:0051225) Spindle Localization (GO:0051653) Telomere Localization (GO:0034397)  | 
		
| Molecular Function | Dynein Complex Binding (GO:0070840) Identical Protein Binding (GO:0042802)  | 
		
Interactions with Nuclear Envelope proteins (8 interactors) | 
		|||
|---|---|---|---|
| Partner (NucEnvDB) | IntAct | Confidence score | |
| P03185 | Nuclear egress protein 2 | EBI-11736405 | 0.37 | 
| Q06616 | Nuclear envelope protein YPR174C | EBI-11535750 | 0.56 | 
| Q5SQN1 | Synaptosomal-associated protein 47 | EBI-24469364 | 0.56 | 
| Q8IY26 | Polyisoprenoid diphosphate/phosphate phosphohydrolase PLPP6 | EBI-24446133 | 0.56 | 
| Q9HC62 | Sentrin-specific protease 2 | EBI-10310610 | 0.72 | 
| Q12382 | CTP-dependent diacylglycerol kinase 1 | EBI-11537331 | 0.56 | 
| P50402 | Emerin | EBI-11774371 | 0.79 | 
| P39996 | Glutathione transferase 3 | EBI-11530258 | 0.56 | Interactions with other proteins (150 interactors) | 
		
| Partner (UniProt) | IntAct | Confidence score | |
| Q9NVE4 | Coiled-coil domain-containing protein 87 | EBI-757171 | 0.37 | 
| Q5NID9 | Elongation factor Tu (EF-Tu) | EBI-2802245 | 0.00 | 
| O60341 | Lysine-specific histone demethylase 1A (EC 1.14.99.66) (BRAF35-HDAC complex protein BHC110) (Flavin-containing amine oxidase domain-containing protein 2) ([histone H3]-dimethyl-L-lysine(4) FAD-dependent demethylase 1A) | EBI-8466533 | 0.37 | 
| Q63HK5 | Teashirt homolog 3 (Zinc finger protein 537) | EBI-10171916 | 0.56 | 
| A8K660 | Adiponectin (Adiponectin, C1Q and collagen domain containing) (cDNA FLJ78108, highly similar to Homo sapiens adiponectin, C1Q and collagen domain containing (ADIPOQ), mRNA) | EBI-10174501 | 0.56 | 
| B2R9H7 | Uroplakin-1b (Uroplakin Ib) | EBI-10175724 | 0.56 | 
| D3DR40 | Chromosome 10 open reading frame 4, isoform CRA_b | EBI-10176580 | 0.56 | 
| O00155 | Probable G-protein coupled receptor 25 | EBI-10178982 | 0.72 | 
| O00526 | Uroplakin-2 (UP2) (Uroplakin II) (UPII) | EBI-10179689 | 0.56 | 
| O00631 | Sarcolipin | EBI-10180799 | 0.56 | 
| O14653 | Golgi SNAP receptor complex member 2 (27 kDa Golgi SNARE protein) (Membrin) | EBI-10181300 | 0.72 | 
| O43765 | Small glutamine-rich tetratricopeptide repeat-containing protein alpha (Alpha-SGT) (Vpu-binding protein) (UBP) | EBI-10185924 | 0.79 | 
| O75379 | Vesicle-associated membrane protein 4 (VAMP-4) | EBI-10188020 | 0.56 | 
| O75431 | Metaxin-2 (Mitochondrial outer membrane import complex protein 2) | EBI-10188246 | 0.72 | 
| O95210 | Starch-binding domain-containing protein 1 (Genethonin-1) (Glycophagy cargo receptor STBD1) | EBI-10191271 | 0.56 | 
| O95954 | Formimidoyltransferase-cyclodeaminase (Formiminotransferase-cyclodeaminase) (FTCD) (LCHC1) [Includes: Glutamate formimidoyltransferase (EC 2.1.2.5) (Glutamate formiminotransferase) (Glutamate formyltransferase); Formimidoyltetrahydrofolate cyclodeaminase (EC 4.3.1.4) (Formiminotetrahydrofolate cyclodeaminase)] | EBI-10192646 | 0.56 | 
| P11836 | B-lymphocyte antigen CD20 (B-lymphocyte surface antigen B1) (Bp35) (Leukocyte surface antigen Leu-16) (Membrane-spanning 4-domains subfamily A member 1) (CD antigen CD20) | EBI-10197695 | 0.56 | 
| P15622 | Zinc finger protein 250 (Zinc finger protein 647) | EBI-10199056 | 0.56 | 
| P16234 | Platelet-derived growth factor receptor alpha (PDGF-R-alpha) (PDGFR-alpha) (EC 2.7.10.1) (Alpha platelet-derived growth factor receptor) (Alpha-type platelet-derived growth factor receptor) (CD140 antigen-like family member A) (CD140a antigen) (Platelet-derived growth factor alpha receptor) (Platelet-derived growth factor receptor 2) (PDGFR-2) (CD antigen CD140a) | EBI-10199272 | 0.56 | 
| P17544 | Cyclic AMP-dependent transcription factor ATF-7 (cAMP-dependent transcription factor ATF-7) (Activating transcription factor 7) (Transcription factor ATF-A) | EBI-10200009 | 0.56 | 
| P23763 | Vesicle-associated membrane protein 1 (VAMP-1) (Synaptobrevin-1) | EBI-10201363 | 0.56 | 
| P29373 | Cellular retinoic acid-binding protein 2 (Cellular retinoic acid-binding protein II) (CRABP-II) | EBI-10204814 | 0.72 | 
| P42857 | Neuronal vesicle trafficking-associated protein 1 (Neuron-enriched endosomal protein of 21 kDa) (Neuron-specific protein family member 1) | EBI-10208892 | 0.72 | 
| P50281 | Matrix metalloproteinase-14 (MMP-14) (EC 3.4.24.80) (MMP-X1) (Membrane-type matrix metalloproteinase 1) (MT-MMP 1) (MTMMP1) (Membrane-type-1 matrix metalloproteinase) (MT1-MMP) (MT1MMP) | EBI-10211798 | 0.56 | 
| P56748 | Claudin-8 | EBI-10215655 | 0.56 | 
| P60520 | Gamma-aminobutyric acid receptor-associated protein-like 2 (GABA(A) receptor-associated protein-like 2) (Ganglioside expression factor 2) (GEF-2) (General protein transport factor p16) (Golgi-associated ATPase enhancer of 16 kDa) (GATE-16) (MAP1 light chain 3-related protein) | EBI-10217795 | 0.56 | 
| Q04941 | Proteolipid protein 2 (Differentiation-dependent protein A4) (Intestinal membrane A4 protein) | EBI-10223541 | 0.56 | 
| Q07325 | C-X-C motif chemokine 9 (Gamma-interferon-induced monokine) (Monokine induced by interferon-gamma) (HuMIG) (MIG) (Small-inducible cytokine B9) | EBI-10224666 | 0.56 | 
| Q10471 | Polypeptide N-acetylgalactosaminyltransferase 2 (EC 2.4.1.41) (Polypeptide GalNAc transferase 2) (GalNAc-T2) (pp-GaNTase 2) (Protein-UDP acetylgalactosaminyltransferase 2) (UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 2) [Cleaved into: Polypeptide N-acetylgalactosaminyltransferase 2 soluble form] | EBI-10226993 | 0.72 | 
| Q13021 | MAL-like protein (Protein BENE) | EBI-10227634 | 0.56 | 
| Q13190 | Syntaxin-5 | EBI-10228578 | 0.72 | 
| Q3B820 | Protein FAM161A | EBI-10240519 | 0.56 | 
| Q53XK0 | BET1 homolog (S. cerevisiae) (BET1 homolog (S. cerevisiae), isoform CRA_d) (cDNA, FLJ94635, Homo sapiens BET1 homolog (S. cerevisiae) (BET1), mRNA) | EBI-10242941 | 0.56 | 
| Q5QGT7 | Receptor-transporting protein 2 (3CxxC-type zinc finger protein 2) | EBI-10244785 | 0.56 | 
| Q5T3I0 | G patch domain-containing protein 4 | EBI-10245269 | 0.72 | 
| Q5TAB7 | Protein ripply2 | EBI-10246926 | 0.79 | 
| Q6N075 | Molybdate-anion transporter (Major facilitator superfamily domain-containing protein 5) (Molybdate transporter 2 homolog) (hsMOT2) | EBI-10250847 | 0.56 | 
| Q6NYC8 | Phostensin (Protein phosphatase 1 F-actin cytoskeleton-targeting subunit) (Protein phosphatase 1 regulatory subunit 18) | EBI-10251924 | 0.72 | 
| Q6P1J9 | Parafibromin (Cell division cycle protein 73 homolog) (Hyperparathyroidism 2 protein) | EBI-10252374 | 0.72 | 
| Q6PKG0 | La-related protein 1 (La ribonucleoprotein domain family member 1) | EBI-10254142 | 0.56 | 
| Q6UX06 | Olfactomedin-4 (OLM4) (Antiapoptotic protein GW112) (G-CSF-stimulated clone 1 protein) (hGC-1) (hOLfD) | EBI-10254551 | 0.56 | 
| Q7L4I2 | Arginine/serine-rich coiled-coil protein 2 | EBI-10256242 | 0.56 | 
| Q86YD7 | Protein FAM90A1 | EBI-10260946 | 0.56 | 
| Q8IVW4 | Cyclin-dependent kinase-like 3 (EC 2.7.11.22) (Serine/threonine-protein kinase NKIAMRE) | EBI-10261805 | 0.56 | 
| Q8N511 | Transmembrane protein 199 | EBI-10265839 | 0.56 | 
| Q8N5M9 | Protein jagunal homolog 1 | EBI-10266794 | 0.72 | 
| Q8N6R1 | Stress-associated endoplasmic reticulum protein 2 (Ribosome-associated membrane protein RAMP4-2) | EBI-10267201 | 0.72 | 
| Q8TAF8 | LHFPL tetraspan subfamily member 5 protein (Lipoma HMGIC fusion partner-like 5 protein) (Tetraspan membrane protein of hair cell stereocilia) | EBI-10271708 | 0.81 | 
| Q92843 | Bcl-2-like protein 2 (Bcl2-L-2) (Apoptosis regulator Bcl-W) | EBI-10279533 | 0.79 | 
| Q969F0 | Fetal and adult testis-expressed transcript protein (Cancer/testis antigen 43) (CT43) (Tumor antigen BJ-HCC-2) | EBI-10280499 | 0.72 | 
| Q96BZ8 | Leukocyte receptor cluster member 1 | EBI-10282764 | 0.56 | 
| Q96DI8 | Heme oxygenase (EC 1.14.14.18) | EBI-10284698 | 0.56 | 
| Q96HV5 | Transmembrane protein 41A | EBI-10288899 | 0.56 | 
| Q96JW4 | Solute carrier family 41 member 2 | EBI-10290136 | 0.72 | 
| Q96Q77 | Calcium and integrin-binding family member 3 (Kinase-interacting protein 3) (KIP 3) | EBI-10292805 | 0.56 | 
| Q96SE0 | Protein ABHD1 (EC 3.1.1.-) (Alpha/beta hydrolase domain-containing protein 1) (Abhydrolase domain-containing protein 1) (Lung alpha/beta hydrolase 1) | EBI-10293347 | 0.56 | 
| Q9BQ70 | Transcription factor 25 (TCF-25) (Nuclear localized protein 1) | EBI-10296328 | 0.56 | 
| Q9BQA9 | Cytochrome b-245 chaperone 1 (Essential for reactive oxygen species protein) (Eros) | EBI-10296518 | 0.72 | 
| Q9BRI3 | Zinc transporter 2 (ZnT-2) (Solute carrier family 30 member 2) | EBI-10296832 | 0.81 | 
| Q9NQ35 | Nuclear receptor-interacting protein 3 (Sarcoma antigen NY-SAR-105) | EBI-10311733 | 0.72 | 
| Q9NRQ5 | Single-pass membrane and coiled-coil domain-containing protein 4 (Protein FN5) | EBI-10312978 | 0.56 | 
| Q9NRS4 | Transmembrane protease serine 4 (EC 3.4.21.-) (Channel-activating protease 2) (CAPH2) (Membrane-type serine protease 2) (MT-SP2) [Cleaved into: Transmembrane protease serine 4 catalytic chain] | EBI-10313004 | 0.56 | 
| Q9NTX7 | E3 ubiquitin-protein ligase RNF146 (EC 2.3.2.27) (Dactylidin) (Iduna) (RING finger protein 146) (RING-type E3 ubiquitin transferase RNF146) | EBI-11774361 | 0.70 | 
| Q9P0N8 | E3 ubiquitin-protein ligase MARCHF2 (EC 2.3.2.27) (Membrane-associated RING finger protein 2) (Membrane-associated RING-CH protein II) (MARCH-II) (RING finger protein 172) (RING-type E3 ubiquitin transferase MARCHF2) | EBI-10317638 | 0.56 | 
| Q9P0S9 | Transmembrane protein 14C | EBI-10317744 | 0.56 | 
| Q9UL15 | BAG family molecular chaperone regulator 5 (BAG-5) (Bcl-2-associated athanogene 5) | EBI-10323400 | 0.72 | 
| Q9Y228 | TRAF3-interacting JNK-activating modulator (TRAF3-interacting protein 3) | EBI-10325376 | 0.72 | 
| Q9Y287 | Integral membrane protein 2B (Immature BRI2) (imBRI2) (Protein E25B) (Transmembrane protein BRI) (Bri) [Cleaved into: BRI2, membrane form (Mature BRI2) (mBRI2); BRI2 intracellular domain (BRI2 ICD); BRI2C, soluble form; Bri23 peptide (Bri2-23) (ABri23) (C-terminal peptide) (P23 peptide)] | EBI-10325842 | 0.56 | 
| Q9Y3D6 | Mitochondrial fission 1 protein (FIS1 homolog) (hFis1) (Tetratricopeptide repeat protein 11) (TPR repeat protein 11) | EBI-10327740 | 0.56 | 
| P0C739 | Protein BNLF2a | EBI-11736458 | 0.37 | 
| P06197 | CDP-diacylglycerol--inositol 3-phosphatidyltransferase (EC 2.7.8.11) (Phosphatidylinositol synthase) (PI synthase) (PtdIns synthase) | EBI-11522953 | 0.56 | 
| P0CD91 | Aquaporin-1 | EBI-11523095 | 0.56 | 
| P11972 | Protein SST2 | EBI-11523210 | 0.56 | 
| P12945 | N-terminal acetyltransferase A complex subunit NAT1 (NatA complex subunit NAT1) (Amino-terminal, alpha-amino, acetyltransferase 1) | EBI-11523283 | 0.56 | 
| P23968 | V-type proton ATPase subunit c'' (V-ATPase subunit c'') (V-ATPase 22 kDa proteolipid subunit) (Vacuolar proton pump c'' subunit) | EBI-11524128 | 0.56 | 
| P28496 | Ceramide synthase LAC1 (Very-long-chain ceramide synthase LAC1) (EC 2.3.1.297) | EBI-11525135 | 0.56 | 
| P32453 | Protein ATP11, mitochondrial | EBI-11525349 | 0.56 | 
| P32502 | Translation initiation factor eIF-2B subunit beta (GCD complex subunit GCD7) (Guanine nucleotide exchange factor subunit GCD7) (eIF-2B GDP-GTP exchange factor subunit beta) | EBI-11526099 | 0.56 | 
| P35179 | Protein transport protein SSS1 (Sec61 complex subunit SSS1) (Sec61 complex subunit gamma) (Ssh1 complex subunit SSS1) (Ssh1 complex subunit gamma) | EBI-11527246 | 0.56 | 
| P38084 | Leu/Val/Ile amino-acid permease (Branched-chain amino-acid permease 2) | EBI-11527720 | 0.56 | 
| P38206 | Oligosaccharide translocation protein RFT1 (Requiring fifty-three protein 1) | EBI-11527956 | 0.56 | 
| P38695 | Probable glucose transporter HXT5 | EBI-11529286 | 0.56 | 
| P38736 | Golgi SNAP receptor complex member 1 (Golgi SNARE protein 1) (Protein transport protein GOS1) | EBI-11529354 | 0.56 | 
| P38842 | UPF0641 membrane protein YHR140W | EBI-11529602 | 0.56 | 
| P38837 | Protein NSG1 (INSIG homolog 1) | EBI-11529584 | 0.56 | 
| P40312 | Cytochrome b5 | EBI-11530656 | 0.56 | 
| P40533 | Protein TED1 (Trafficking of EMP24/ERV25-dependent cargo disrupted protein 1) | EBI-11531474 | 0.56 | 
| P40567 | U2 small nuclear ribonucleoprotein B'' (U2 snRNP B'') | EBI-11531531 | 0.56 | 
| P46956 | Inorganic phosphate transporter PHO86 | EBI-11532079 | 0.56 | 
| P46965 | Signal peptidase complex subunit 1 (Microsomal signal peptidase subunit 1) | EBI-11532098 | 0.56 | 
| P47013 | Dihydrosphingosine 1-phosphate phosphatase LCB3 (EC 3.1.3.-) (Long-chain base protein 3) (Sphingolipid resistance protein 2) | EBI-11532127 | 0.56 | 
| P53012 | Acyl-coenzyme A diphosphatase SCS3 (EC 3.6.1.-) (FIT family protein SCS3) | EBI-11532979 | 0.56 | 
| P53142 | Vacuolar protein sorting-associated protein 73 | EBI-11533081 | 0.56 | 
| P53337 | ER-derived vesicles protein ERV29 | EBI-11533532 | 0.56 | 
| P53730 | Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase (EC 2.4.1.260) (Asparagine-linked glycosylation protein 12) (Dolichyl-P-Man:Man(7)GlcNAc(2)-PP-dolichyl-alpha-1,6-mannosyltransferase) (Extracellular mutant protein 39) (Mannosyltransferase ALG12) | EBI-11533568 | 0.56 | 
| P53906 | Uncharacterized protein YNL146W | EBI-11533819 | 0.56 | 
| Q01590 | Integral membrane protein SED5 | EBI-11534163 | 0.56 | 
| Q02724 | Ubiquitin-like-specific protease 1 (EC 3.4.22.68) | EBI-11534307 | 0.56 | 
| Q03579 | Ceramide synthase subunit LIP1 (LAG1/LAC1-interacting protein 1) | EBI-11534893 | 0.56 | 
| Q03714 | U1 SNP1-associating protein 1 | EBI-11534941 | 0.56 | 
| Q03860 | Golgi apparatus membrane protein TVP15 (TLG2 compartment vesicle protein 15) (TLG2-vesicle protein of 15 kDa) | EBI-11535004 | 0.56 | 
| Q04969 | Signal peptidase complex subunit 2 (Microsomal signal peptidase subunit 2) | EBI-11535341 | 0.56 | 
| Q08144 | t-SNARE affecting a late Golgi compartment protein 2 (Syntaxin TLG2) | EBI-11536212 | 0.56 | 
| Q12118 | Small glutamine-rich tetratricopeptide repeat-containing protein 2 (SGT/UBP) (Viral protein U-binding protein) | EBI-11536557 | 0.56 | 
| Q12259 | BTB/POZ domain-containing protein YLR108C | EBI-11537012 | 0.56 | 
| Q12431 | ER membrane protein complex subunit 6 | EBI-11537378 | 0.56 | 
| Q12746 | Plasma membrane-associated coenzyme Q6 reductase PGA3 (EC 1.6.2.2) (Processing of GAS1 and ALP protein 3) | EBI-11537533 | 0.56 | 
| Q6Q595 | Vesicle-associated membrane protein-associated protein SCS22 (VAMP-associated protein SCS22) (VAP homolog 2) | EBI-11537600 | 0.56 | 
| Q8TGQ7 | Uncharacterized protein YPR159C-A | EBI-11537661 | 0.56 | 
| P34897 | Serine hydroxymethyltransferase, mitochondrial (SHMT) (EC 2.1.2.1) (Glycine hydroxymethyltransferase) (Serine methylase) | EBI-11774291 | 0.49 | 
| Q96HA8 | Protein N-terminal glutamine amidohydrolase (EC 3.5.1.122) (Protein NH2-terminal glutamine deamidase) (N-terminal Gln amidase) (Nt(Q)-amidase) (WDYHV motif-containing protein 1) | EBI-11774311 | 0.49 | 
| P17152 | Transmembrane protein 11, mitochondrial (Protein PM1) (Protein PMI) | EBI-11774321 | 0.70 | 
| O43561 | Linker for activation of T-cells family member 1 (36 kDa phospho-tyrosine adapter protein) (pp36) (p36-38) | EBI-11774341 | 0.49 | 
| Q969S0 | UDP-xylose and UDP-N-acetylglucosamine transporter (Solute carrier family 35 member B4) (YEA4 homolog) | EBI-24288362 | 0.56 | 
| P52803 | Ephrin-A5 (AL-1) (EPH-related receptor tyrosine kinase ligand 7) (LERK-7) | EBI-24297738 | 0.56 | 
| O00264 | Membrane-associated progesterone receptor component 1 (mPR) (Dap1) (IZA) | EBI-24315794 | 0.56 | 
| Q9UHJ9 | Post-GPI attachment to proteins factor 2 (FGF receptor-activating protein 1) | EBI-24336298 | 0.56 | 
| Q96HH6 | Transmembrane protein 19 | EBI-24338645 | 0.56 | 
| P63027 | Vesicle-associated membrane protein 2 (VAMP-2) (Synaptobrevin-2) | EBI-24343261 | 0.56 | 
| Q53FD0 | Zinc finger C2HC domain-containing protein 1C | EBI-24350172 | 0.56 | 
| Q96LL9 | DnaJ homolog subfamily C member 30, mitochondrial (Williams-Beuren syndrome chromosomal region 18 protein) | EBI-24351872 | 0.56 | 
| Q96D05 | Protein FAM241B | EBI-24358633 | 0.56 | 
| O15155 | BET1 homolog (hBET1) (Golgi vesicular membrane-trafficking protein p18) | EBI-24361171 | 0.56 | 
| Q5W5X9 | Tetratricopeptide repeat protein 23 (TPR repeat protein 23) (Cervical cancer proto-oncogene 8 protein) (HCC-8) | EBI-25246714 | 0.56 | 
| Q8N2M4 | Lysoplasmalogenase-like protein TMEM86A (Transmembrane protein 86A) | EBI-25251117 | 0.56 | 
| O75841 | Uroplakin-1b (UP1b) (Tetraspanin-20) (Tspan-20) (Uroplakin Ib) (UPIb) | EBI-24480378 | 0.56 | 
| A5PKU2 | TUSC5 protein | EBI-24482338 | 0.56 | 
| P01375 | Tumor necrosis factor (Cachectin) (TNF-alpha) (Tumor necrosis factor ligand superfamily member 2) (TNF-a) [Cleaved into: Tumor necrosis factor, membrane form (N-terminal fragment) (NTF); Intracellular domain 1 (ICD1); Intracellular domain 2 (ICD2); C-domain 1; C-domain 2; Tumor necrosis factor, soluble form] | EBI-24492243 | 0.56 | 
| Q96HB5 | Coiled-coil domain-containing protein 120 | EBI-24497344 | 0.56 | 
| O95159 | Zinc finger protein-like 1 (Zinc finger protein MCG4) | EBI-24375600 | 0.56 | 
| Q8IVJ1 | Solute carrier family 41 member 1 | EBI-24380121 | 0.56 | 
| Q2TBE0 | CWF19-like protein 2 | EBI-24388099 | 0.56 | 
| Q9BVK8 | Transmembrane protein 147 (Protein NIFIE 14) | EBI-24391713 | 0.56 | 
| Q14802 | FXYD domain-containing ion transport regulator 3 (Chloride conductance inducer protein Mat-8) (Mammary tumor 8 kDa protein) (Phospholemman-like) (Sodium/potassium-transporting ATPase subunit FXYD3) | EBI-24404702 | 0.56 | 
| Q86Y82 | Syntaxin-12 | EBI-24409778 | 0.56 | 
| Q9BUN8 | Derlin-1 (Degradation in endoplasmic reticulum protein 1) (DERtrin-1) (Der1-like protein 1) | EBI-24409708 | 0.56 | 
| Q8N912 | Nutritionally-regulated adipose and cardiac enriched protein homolog | EBI-25261754 | 0.56 | 
| Q96DZ9 | CKLF-like MARVEL transmembrane domain-containing protein 5 (Chemokine-like factor superfamily member 5) | EBI-24419119 | 0.56 | 
| Q86W74 | Ankyrin repeat domain-containing protein 46 (Ankyrin repeat small protein) (ANK-S) | EBI-24441079 | 0.56 | 
| Q9H490 | Phosphatidylinositol glycan anchor biosynthesis class U protein (Cell division cycle protein 91-like 1) (Protein CDC91-like 1) (GPI transamidase component PIG-U) | EBI-24449445 | 0.56 | 
| Q9Y247 | Protein FAM50B (Protein XAP-5-like) | EBI-24449816 | 0.56 | 
| Q9NY91 | Solute carrier family 5 member 4 | EBI-24450486 | 0.56 | 
| P11215 | Integrin alpha-M (CD11 antigen-like family member B) (CR-3 alpha chain) (Cell surface glycoprotein MAC-1 subunit alpha) (Leukocyte adhesion receptor MO1) (Neutrophil adherence receptor) (CD antigen CD11b) | EBI-24452528 | 0.56 | 
| O75425 | Motile sperm domain-containing protein 3 | EBI-24454568 | 0.56 | 
| Q9UEU0 | Vesicle transport through interaction with t-SNAREs homolog 1B (Vesicle transport v-SNARE protein Vti1-like 1) (Vti1-rp1) | EBI-24455064 | 0.56 | 
| Q96F15 | GTPase IMAP family member 5 (Immune-associated nucleotide-binding protein 5) (Immunity-associated nucleotide 4-like 1 protein) (Immunity-associated nucleotide 5 protein) (IAN-5) (hIAN5) (Immunity-associated protein 3) | EBI-24463545 | 0.56 | 
| Q4LDR2 | Cortexin-3 (Kidney and brain-expressed protein) | EBI-24465439 | 0.56 | 
| Q9UHP6 | Radial spoke head 14 homolog (Rhabdoid tumor deletion region protein 1) | EBI-24468231 | 0.56 | 
| O75427 | Leucine-rich repeat and calponin homology domain-containing protein 4 (Leucine-rich repeat neuronal protein 4) (Leucine-rich neuronal protein) | EBI-24473887 | 0.56 | 
| Q15848 | Adiponectin (30 kDa adipocyte complement-related protein) (Adipocyte complement-related 30 kDa protein) (ACRP30) (Adipocyte, C1q and collagen domain-containing protein) (Adipose most abundant gene transcript 1 protein) (apM-1) (Gelatin-binding protein) | EBI-12702786 | 0.56 | 
Database | Links | 
| UNIPROT | Q8N6L0 Q96MC3 | 
| PDB | 6R2I 6WMF | 
| Pfam | PF14658 PF14662 | 
| OMIM | 618125 | 
| DisGeNET | 147872 | 
	National and Kapodistrian University of Athens
	Department of Biology
     	Biophysics & Bioinformatics Laboratory