NucEnvDB

NucEnvDB

A database of Nuclear Envelope Proteins and their Interactions

Proline-rich protein 7 - Homo sapiens - NucEnvDB

Proline-rich protein 7 (Homo sapiens)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	Proline-rich protein 7
Accession Code	Q8TB68
Gene	PRR7
Organism	Homo sapiens \| Human (Taxonomy: 9606)
Part of Reference Proteome?	Yes
Sequence (Length: 274)
MVMSQGTYTFLTCFAGFWLIWGLIVLLCCFCSFLRRRLKRRQEERLREQNLRALELEPLELEGSLAGSPPGLAPPQPPPHRSRLEAPAHAHSHPHVHVHPLLHHGPAQPHAHAHPHPHHHALPHPPPTHL SVPPRPWSYPRQAESDMSKPPCYEEAVLMAEPPPPYSEVLTDTRGLYRKIVTPFLSRRDSAEKQEQPPPSYKPLFLDRGYTSALHLPSAPRPAPPCPALCLQADRGRRVFPSWTDSELSSREPLEHGAWR LPVSIPLFGRTTAV

Subcellular Location

Description
Cell membrane {Experimental EvidencePubMed:21460222}; Single-pass type III membrane protein {Curator Inference}. Postsynaptic cell membrane {By SimilarityUniProtKB:P0C6T3}; Single-pass type III membrane protein {Curator Inference}. Postsynaptic density membrane {By SimilarityUniProtKB:P0C6T3}. Cytoplasm, perinuclear region {Experimental EvidencePubMed:21460222}. Synapse {ECO:0000269\|PubMed:27458189}. Cell projection, dendrite {ECO:0000269\|PubMed:27458189}. Nucleus {ECO:0000269\|PubMed:27458189}. Note=Enriched in postsynaptic plasma membrane and postsynaptic densities (PSD). Accumulates in spines along with synapse maturation and colocalizes with DLG4 in a punctate pattern. Translocates from synapses to nuclei following NMDA receptor activity (By similarity). {By SimilarityUniProtKB:P0C6T3}.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Transmembrane	UniProt	Sequence Analysis {ECO:0000255}
Assigned Ontology terms

Cellular Component	Anchoring Junction (GO:0070161) Cytosol (GO:0005829) Dendrite (GO:0030425) Glutamatergic Synapse (GO:0098978) Nucleoplasm (GO:0005654) Perinuclear Region Of Cytoplasm (GO:0048471) Plasma Membrane (GO:0005886) Postsynaptic Density Membrane (GO:0098839) Postsynaptic Density, Intracellular Component (GO:0099092)

Biology & Function

Description
Acts as a synapse-to-nucleus messenger to promote NMDA receptor-mediated excitotoxicity in neurons in a JUN-dependent manner (By similarity). Inhibits ubiquitination-mediated degradation and promotes phosphorylation and transcriptional activity of transcription factor JUN (PubMed:27458189). Might play a redundant role in the regulation of T cell receptor signaling (PubMed:21460222). Might promote apoptosis in T cells (PubMed:21460222). {By SimilarityUniProtKB:P0C6T3, By SimilarityUniProtKB:Q3V0I2, Experimental EvidencePubMed:21460222, Experimental EvidencePubMed:27458189}.
Assigned Ontology terms

Biological Process	Adaptive Immune Response (GO:0002250) Alpha-Beta T Cell Differentiation (GO:0046632) Negative Regulation Of Protein Ubiquitination (GO:0031397) Positive Regulation Of Apoptotic Process (GO:0043065) Positive Regulation Of Cell Death (GO:0010942) Positive Regulation Of Cysteine-Type Endopeptidase Activity Involved In Apoptotic Signaling Pathway (GO:2001269) Postsynapse To Nucleus Signaling Pathway (GO:0099527) T Cell Differentiation In Thymus (GO:0033077)
Molecular Function	Long-Chain Fatty Acid Binding (GO:0036041) Protein Tyrosine Kinase Binding (GO:1990782) Protein-Containing Complex Binding (GO:0044877) Ubiquitin-Like Protein Ligase Binding (GO:0044389)

Protein-Protein Interactions

Interactions with other proteins (3 interactors)

Partner (UniProt)		IntAct	Confidence score
A8K8V0	Zinc finger protein 785	EBI-3925408	0.37
P46934	E3 ubiquitin-protein ligase NEDD4 (EC 2.3.2.26) (Cell proliferation-inducing gene 53 protein) (HECT-type E3 ubiquitin transferase NEDD4) (Neural precursor cell expressed developmentally down-regulated protein 4) (NEDD-4)	EBI-30833480	0.44
P46937	Transcriptional coactivator YAP1 (Yes-associated protein 1) (Protein yorkie homolog) (Yes-associated protein YAP65 homolog)	EBI-30847770	0.44

Cross-References

Database	Links
UNIPROT	Q8TB68 Q8WU53 Q9BTA7
OMIM	618306
DisGeNET	80758

Powered by W3.css | Privacy Notice

x

This website uses cookies to improve user experience. By using NucEnvDB you consent to all cookies in accordance with our privacy policy. OK