Short transient receptor potential channel 4-associated protein - Homo sapiens

Short transient receptor potential channel 4-associated protein (Homo sapiens)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	Short transient receptor potential channel 4-associated protein
Accession Code	Q8TEL6
Gene	TRPC4AP
Organism	Homo sapiens \| Human (Taxonomy: 9606)
Part of Reference Proteome?	Yes
Sequence (Length: 797)
MAAAPVAAGSGAGRGRRSAATVAAWGGWGGRPRPGNILLQLRQGQLTGRGLVRAVQFTETFLTERDKQSKWSGIPQLLLKLHTTSHLHSDFVECQNILKEISPLLSMEAMAFVTEERKLTQETTYPNTYI FDLFGGVDLLVEILMRPTISIRGQKLKISDEMSKDCLSILYNTCVCTEGVTKRLAEKNDFVIFLFTLMTSKKTFLQTATLIEDILGVKKEMIRLDEVPNLSSLVSNFDQQQLANFCRILAVTISEMDTGN DDKHTLLAKNAQQKKSLSLGPSAAEINQAALLSIPGFVERLCKLATRKVSESTGTASFLQELEEWYTWLDNALVLDALMRVANEESEHNQASIVFPPPGASEENGLPHTSARTQLPQSMKIMHEIMYKLE VLYVLCVLLMGRQRNQVHRMIAEFKLIPGLNNLFDKLIWRKHSASALVLHGHNQNCDCSPDITLKIQFLRLLQSFSDHHENKYLLLNNQELNELSAISLKANIPEVEAVLNTDRSLVCDGKRGLLTRLLQ VMKKEPAESSFRFWQARAVESFLRGTTSYADQMFLLKRGLLEHILYCIVDSECKSRDVLQSYFDLLGELMKFNVDAFKRFNKYINTDAKFQVFLKQINSSLVDSNMLVRCVTLSLDRFENQVDMKVAEVL SECRLLAYISQVPTQMSFLFRLINIIHVQTLTQENVSCLNTSLVILMLARRKERLPLYLRLLQRMEHSKKYPGFLLNNFHNLLRFWQQHYLHKDKDSTCLENSSCISFSYWKETVSILLNPDRQSPSALV SYIEEPYMDIDRDFTEE

Subcellular Location

Description
Cytoplasm, perinuclear region {Experimental EvidencePubMed:26038816}.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Unknown	UniProt	Sequence Analysis
Assigned Ontology terms

Cellular Component	Cul4-RING E3 Ubiquitin Ligase Complex (GO:0080008) Cul4A-RING E3 Ubiquitin Ligase Complex (GO:0031464) Perinuclear Region Of Cytoplasm (GO:0048471) Plasma Membrane (GO:0005886)

Biology & Function

Description
Substrate-recognition component of a DCX (DDB1-CUL4-X-box) E3 ubiquitin-protein ligase complex required for cell cycle control (PubMed:20551172, PubMed:29779948). The DCX(TRPC4AP) complex specifically mediates the polyubiquitination and subsequent degradation of MYC as part of the DesCEND (destruction via C-end degrons) pathway (PubMed:20551172, PubMed:29779948). The DesCEND (destruction via C-end degrons) pathway recognizes a C-degron located at the extreme C terminus of target proteins, leading to their ubiquitination and degradation (PubMed:29779948). The DCX(TRPC4AP) complex specifically recognizes proteins with an arginine at the minus 3 position (R-3 motif) at the C-terminus, such as MYC, leading to their ubiquitination and degradation (PubMed:29779948). Also participates in the activation of NFKB1 in response to ligation of TNFRSF1A, possibly by linking TNFRSF1A to the IKK signalosome (By similarity). Involved in JNK activation via its interaction with TRAF2 (By similarity). Also involved in elevation of endoplasmic reticulum Ca(2+) storage reduction in response to CHRM1 (By similarity). {By SimilarityUniProtKB:Q9JLV2, Experimental EvidencePubMed:20551172, Experimental EvidencePubMed:29779948}.
Assigned Ontology terms

Biological Process	Calcium Ion Transmembrane Transport (GO:0070588) Hair Follicle Maturation (GO:0048820) Protein Ubiquitination (GO:0016567) Ubiquitin-Dependent Protein Catabolic Process (GO:0006511) Ubiquitin-Dependent Protein Catabolic Process Via The C-End Degron Rule Pathway (GO:0140627)
Molecular Function	Calcium Channel Activity (GO:0005262) Phosphatase Binding (GO:0019902) Ubiquitin Ligase-Substrate Adaptor Activity (GO:1990756)

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (4 interactors)

Partner (NucEnvDB)		IntAct	Confidence score
O43633	Charged multivesicular body protein 2a	EBI-11512033	0.37
Q92905	COP9 signalosome complex subunit 5	EBI-21325777	0.35
Q7L5N1	COP9 signalosome complex subunit 6	EBI-21332205	0.35
P12931	Proto-oncogene tyrosine-protein kinase Src	EBI-28931938	0.35
Interactions with other proteins (39 interactors)

Partner (UniProt)		IntAct	Confidence score
Q12933	TNF receptor-associated factor 2 (EC 2.3.2.27) (E3 ubiquitin-protein ligase TRAF2) (RING-type E3 ubiquitin transferase TRAF2) (Tumor necrosis factor type 2 receptor-associated protein 3)	EBI-8591290	0.40
Q3U1J4	DNA damage-binding protein 1 (DDB p127 subunit) (Damage-specific DNA-binding protein 1) (UV-damaged DNA-binding factor)	EBI-2559059	0.40
A0A4Y1W4N6	SPFH domain/Band 7 family protein	EBI-2810106	0.00
Q15750	TGF-beta-activated kinase 1 and MAP3K7-binding protein 1 (Mitogen-activated protein kinase kinase kinase 7-interacting protein 1) (TGF-beta-activated kinase 1-binding protein 1) (TAK1-binding protein 1)	EBI-7200047	0.37
P62136	Serine/threonine-protein phosphatase PP1-alpha catalytic subunit (PP-1A) (EC 3.1.3.16)	EBI-5238123	0.54
Q13619	Cullin-4A (CUL-4A)	EBI-21324822	0.53
Q13620	Cullin-4B (CUL-4B)	EBI-21332812	0.35
Q9WH76	Matrix protein	EBI-10823934	0.37
Q96CF2	Charged multivesicular body protein 4c (Chromatin-modifying protein 4c) (CHMP4c) (SNF7 homolog associated with Alix 3) (SNF7-3) (hSnf7-3) (Vacuolar protein sorting-associated protein 32-3) (Vps32-3) (hVps32-3)	EBI-11510809	0.37
Q7LBR1	Charged multivesicular body protein 1b (CHMP1.5) (Chromatin-modifying protein 1b) (CHMP1b) (Vacuolar protein sorting-associated protein 46-2) (Vps46-2) (hVps46-2)	EBI-11511928	0.37
Q9NZZ3	Charged multivesicular body protein 5 (Chromatin-modifying protein 5) (SNF7 domain-containing protein 2) (Vacuolar protein sorting-associated protein 60) (Vps60) (hVps60)	EBI-11512563	0.37
Q96FZ7	Charged multivesicular body protein 6 (Chromatin-modifying protein 6) (Vacuolar protein sorting-associated protein 20) (Vps20) (hVps20)	EBI-11512619	0.37
Q13049	E3 ubiquitin-protein ligase TRIM32 (EC 2.3.2.27) (72 kDa Tat-interacting protein) (RING-type E3 ubiquitin transferase TRIM32) (Tripartite motif-containing protein 32) (Zinc finger protein HT2A)	EBI-12452491	0.51
Q13509	Tubulin beta-3 chain (Tubulin beta-4 chain) (Tubulin beta-III)	EBI-11897134	0.35
Q9Y6Y8	SEC23-interacting protein (p125)	EBI-11942723	0.00
Q17RF5	Odontogenesis associated phosphoprotein	EBI-21556823	0.35
Q9Y520	Protein PRRC2C (BAT2 domain-containing protein 1) (HBV X-transactivated gene 2 protein) (HBV XAg-transactivated protein 2) (HLA-B-associated transcript 2-like 2) (Proline-rich and coiled-coil-containing protein 2C)	EBI-21558423	0.35
Q9HCM4	Band 4.1-like protein 5 (Erythrocyte membrane protein band 4.1-like 5)	EBI-21558423	0.35
Q9BYW2	Histone-lysine N-methyltransferase SETD2 (EC 2.1.1.359) (HIF-1) (Huntingtin yeast partner B) (Huntingtin-interacting protein 1) (HIP-1) (Huntingtin-interacting protein B) (Lysine N-methyltransferase 3A) (Protein-lysine N-methyltransferase SETD2) (EC 2.1.1.-) (SET domain-containing protein 2) (hSET2) (p231HBP)	EBI-21558423	0.35
Q9BW61	DET1- and DDB1-associated protein 1 (Placenta cross-immune reaction antigen 1) (PCIA-1)	EBI-21558423	0.35
Q99590	Protein SCAF11 (CTD-associated SR protein 11) (Renal carcinoma antigen NY-REN-40) (SC35-interacting protein 1) (SR-related and CTD-associated factor 11) (SRSF2-interacting protein) (Serine/arginine-rich splicing factor 2-interacting protein) (Splicing factor, arginine/serine-rich 2-interacting protein) (Splicing regulatory protein 129) (SRrp129)	EBI-21558423	0.35
Q96SY0	Integrator complex subunit 14 (von Willebrand factor A domain-containing protein 9)	EBI-21558423	0.35
Q8IWU5	Extracellular sulfatase Sulf-2 (hSulf-2) (EC 3.1.6.-)	EBI-21558423	0.35
Q7Z6E9	E3 ubiquitin-protein ligase RBBP6 (EC 2.3.2.27) (Proliferation potential-related protein) (Protein P2P-R) (RING-type E3 ubiquitin transferase RBBP6) (Retinoblastoma-binding Q protein 1) (RBQ-1) (Retinoblastoma-binding protein 6) (p53-associated cellular protein of testis)	EBI-21558423	0.35
Q6B0I6	Lysine-specific demethylase 4D (EC 1.14.11.66) (JmjC domain-containing histone demethylation protein 3D) (Jumonji domain-containing protein 2D) ([histone H3]-trimethyl-L-lysine(9) demethylase 4D)	EBI-21558423	0.35
Q16531	DNA damage-binding protein 1 (DDB p127 subunit) (DNA damage-binding protein a) (DDBa) (Damage-specific DNA-binding protein 1) (HBV X-associated protein 1) (XAP-1) (UV-damaged DNA-binding factor) (UV-damaged DNA-binding protein 1) (UV-DDB 1) (XPE-binding factor) (XPE-BF) (Xeroderma pigmentosum group E-complementing protein) (XPCe)	EBI-15821456	0.41
Q16204	Coiled-coil domain-containing protein 6 (Papillary thyroid carcinoma-encoded protein) (Protein H4)	EBI-21558423	0.35
Q15788	Nuclear receptor coactivator 1 (NCoA-1) (EC 2.3.1.48) (Class E basic helix-loop-helix protein 74) (bHLHe74) (Protein Hin-2) (RIP160) (Renal carcinoma antigen NY-REN-52) (Steroid receptor coactivator 1) (SRC-1)	EBI-21558423	0.35
Q15751	Probable E3 ubiquitin-protein ligase HERC1 (EC 2.3.2.26) (HECT domain and RCC1-like domain-containing protein 1) (HECT-type E3 ubiquitin transferase HERC1) (p532) (p619)	EBI-21558423	0.35
Q07866	Kinesin light chain 1 (KLC 1)	EBI-21558423	0.35
P48634	Protein PRRC2A (HLA-B-associated transcript 2) (Large proline-rich protein BAT2) (Proline-rich and coiled-coil-containing protein 2A) (Protein G2)	EBI-21558423	0.35
P46940	Ras GTPase-activating-like protein IQGAP1 (p195)	EBI-21558423	0.35
O95297	Myelin protein zero-like protein 1 (Protein zero-related)	EBI-21558423	0.35
O75052	Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein (C-terminal PDZ ligand of neuronal nitric oxide synthase protein) (Nitric oxide synthase 1 adaptor protein)	EBI-21558423	0.35
O43148	mRNA cap guanine-N7 methyltransferase (EC 2.1.1.56) (RG7MT1) (mRNA (guanine-N(7))-methyltransferase) (mRNA cap methyltransferase) (hCMT1) (hMet) (hcm1p)	EBI-21558423	0.35
A6NHR9	Structural maintenance of chromosomes flexible hinge domain-containing protein 1 (SMC hinge domain-containing protein 1) (EC 3.6.1.-)	EBI-21558423	0.35
P13727	Bone marrow proteoglycan (BMPG) (Proteoglycan 2) [Cleaved into: Eosinophil granule major basic protein (EMBP) (MBP) (Pregnancy-associated major basic protein)]	EBI-21570605	0.35
Q9H9P5	Putative E3 ubiquitin-protein ligase UNKL (EC 2.3.2.-) (RING finger protein unkempt-like) (Zinc finger CCCH domain-containing protein 5-like)	EBI-21622067	0.35
Q8WV16	DDB1- and CUL4-associated factor 4 (WD repeat-containing protein 21A)	EBI-30863977	0.35

Cross-References

Database	Links
UNIPROT	Q8TEL6 E1P5Q0 E1P5Q1 Q96H82 Q9BVB8 Q9H429 Q9UFS6
Pfam	PF12463
OMIM	608430
DisGeNET	26133

Short transient receptor potential channel 4-associated protein (Homo sapiens)

General Information

Protein Information

Subcellular Location

Description Show

Position in the Nuclear Envelope

Membrane Topology

Assigned Ontology terms

Biology & Function

Description Hide

Assigned Ontology terms

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (4 interactors)

Interactions with other proteins (39 interactors)

Cross-References

Database

Links

Description

Description