NucEnvDB

NucEnvDB

A database of Nuclear Envelope Proteins and their Interactions

Stathmin-2 - Gallus gallus - NucEnvDB

Stathmin-2 (Gallus gallus)

FASTA TEXT XML

Subcellular Location Biology & Function Cross-References

General Information

Protein Information
Protein Name	Stathmin-2
Accession Code	Q90987
Gene	STMN2
Organism	Gallus gallus \| Chicken (Taxonomy: 9031)
Part of Reference Proteome?	Yes
Sequence (Length: 179)
MAKTAMAYKEKMKELSMLSLICSCFYPEPRNMNIYKYDDMEVKQINKRASGQAFELILKPPSPVSEAPRTLASPKKKELSLEEIQKKLEAAEERRKSQEAQVLKHLAEKREHEREVLQKALEENNNFSKM AEEKLILKMEQIKENREANLAALIERLQEKERHAAEVRRNKELQVELSG

Subcellular Location

Description
Cytoplasm {By Similarity}. Cytoplasm, perinuclear region {By Similarity}. Cell projection, growth cone {By Similarity}. Membrane {ECO:0000305}; Peripheral membrane protein {ECO:0000305}; Cytoplasmic side {ECO:0000305}. Cell projection, axon {By Similarity}. Cell projection, lamellipodium {By Similarity}. Note=Associated with punctate structures in the perinuclear cytoplasm, axons, and growth cones of developing neurons. SCG10 exists in both soluble and membrane- bound forms (By similarity). {By Similarity}.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Peripheral	UniProt	Curator Inference {ECO:0000305}
Assigned Ontology terms

Cellular Component	Cytoplasm (GO:0005737) Growth Cone (GO:0030426) Lamellipodium (GO:0030027) Membrane (GO:0016020) Neuron Projection (GO:0043005) Neuronal Cell Body (GO:0043025) Perinuclear Region Of Cytoplasm (GO:0048471)

Biology & Function

Description
Is a key regulator of neurite extension through regulation of microtubule instabilily. {By Similarity}.
Assigned Ontology terms

Biological Process	Cellular Response To Nerve Growth Factor Stimulus (GO:1990090) Microtubule Depolymerization (GO:0007019) Negative Regulation Of Microtubule Depolymerization (GO:0007026) Negative Regulation Of Microtubule Polymerization (GO:0031115) Negative Regulation Of Neuron Projection Development (GO:0010977) Neuron Projection Development (GO:0031175) Positive Regulation Of Microtubule Depolymerization (GO:0031117) Positive Regulation Of Neuron Projection Development (GO:0010976) Regulation Of Microtubule Polymerization Or Depolymerization (GO:0031110)
Molecular Function	Calcium-Dependent Protein Binding (GO:0048306) Tubulin Binding (GO:0015631)

Cross-References

Database	Links
UNIPROT	Q90987
Pfam	PF00836
PROSITE	PS00563 PS01041 PS51663

Powered by W3.css | Privacy Notice

x

This website uses cookies to improve user experience. By using NucEnvDB you consent to all cookies in accordance with our privacy policy. OK