Protein Information |
|
|---|---|
| Protein Name | Synapse-associated protein 1 |
| Accession Code | Q96A49 |
| Gene | SYAP1 |
| Organism | Homo sapiens | Human (Taxonomy: 9606) |
| Part of Reference Proteome? | Yes |
| Sequence (Length: 352) | |
|
MFRGLSSWLGLQQPVAGGGQPNGDAPPEQPSETVAESAEEELQQAGDQELLHQAKDFGNYLFNFASAATKKITESVAETA QTIKKSVEEGKIDGIIDKTIIGDFQKEQKKFVEEQHTKKSEAAVPPWVDTNDEETIQQQILALSADKRNFLRDPPAGVQF NFDFDQMYPVALVMLQEDELLSKMRFALVPKLVKEEVFWRNYFYRVSLIKQSAQLTALAAQQQAAGKEEKSNGREQDLPL AEAVRPKTPPVVIKSQLKTQEDEEEISTSPGVSEFVSDAFDACNLNQEDLRKEMEQLVLDKKQEETAVLEEDSADWEKEL QQELQEYEVVTESEKRDENWDKEIEKMLQEEN |
|
Structure Viewer (PDB: 1X3A) |
|---|
Description |
||
|---|---|---|
| Cytoplasm, perinuclear region {By SimilarityUniProtKB:Q9D5V6}. Golgi apparatus {By SimilarityUniProtKB:Q9D5V6}. Perikaryon {By SimilarityUniProtKB:Q9D5V6}. Cell projection, axon {By SimilarityUniProtKB:Q9D5V6}. Cell projection, dendrite {By SimilarityUniProtKB:Q9D5V6}. Cell projection, growth cone {By SimilarityUniProtKB:Q9D5V6}. Presynaptic cell membrane {By SimilarityUniProtKB:Q9D5V6}. Postsynaptic cell membrane {By SimilarityUniProtKB:Q9D5V6}. Membrane {ECO:0000269|PubMed:23300339}. Note=Localizes to cholinergic neuromuscular junctions and in actin-rich growth cone regions (By similarity). Membrane-associated in a epidermal growth factor (EGF)-dependent manner (PubMed:23300339). {By SimilarityUniProtKB:Q9D5V6, ECO:0000269|PubMed:23300339}. | Position in the Nuclear Envelope |
|
| Location | Location ID | Description |
| Perinuclear Region | SL-0198 | The perinuclear region is the cytoplasmic region just around the nucleus. | Membrane Topology |
| Topology | Source | Annotation Type |
| Unknown | UniProt | Sequence Analysis | Assigned Ontology terms |
| Cellular Component | Anchoring Junction (GO:0070161) Axon (GO:0030424) Cytoplasm (GO:0005737) Cytosol (GO:0005829) Dendrite (GO:0030425) Extracellular Exosome (GO:0070062) Extrinsic Component Of Cytoplasmic Side Of Plasma Membrane (GO:0031234) Golgi Apparatus (GO:0005794) Growth Cone (GO:0030426) Nucleoplasm (GO:0005654) Nucleus (GO:0005634) Perikaryon (GO:0043204) Perinuclear Region Of Cytoplasm (GO:0048471) Postsynaptic Membrane (GO:0045211) Presynaptic Membrane (GO:0042734) Synapse (GO:0045202) |
|
Description |
|
|---|---|
| Plays a role in adipocyte differentiation by promoting mTORC2-mediated phosphorylation of AKT1 at 'Ser-473' after growth factor stimulation (PubMed:23300339). {Experimental EvidencePubMed:23300339}. | Assigned Ontology terms |
| Biological Process | Cell Differentiation (GO:0030154) Cellular Response To Epidermal Growth Factor Stimulus (GO:0071364) Cellular Response To Insulin Stimulus (GO:0032869) Cellular Response To Insulin-Like Growth Factor Stimulus (GO:1990314) Cellular Response To Platelet-Derived Growth Factor Stimulus (GO:0036120) Positive Regulation Of Fat Cell Differentiation (GO:0045600) Positive Regulation Of Protein Serine/Threonine Kinase Activity (GO:0071902) Regulation Of Short-Term Neuronal Synaptic Plasticity (GO:0048172) TORC2 Signaling (GO:0038203) |
| Molecular Function | |
Interactions with Nuclear Envelope proteins (2 interactors) |
|||
|---|---|---|---|
| Partner (NucEnvDB) | IntAct | Confidence score | |
| Q6ZMQ8 | Serine/threonine-protein kinase LMTK1 | EBI-32723474 | 0.27 |
| P01112 | GTPase HRas, N-terminally processed | EBI-27045317 | 0.27 | Interactions with other proteins (47 interactors) |
| Partner (UniProt) | IntAct | Confidence score | |
| Q16659 | Mitogen-activated protein kinase 6 (MAP kinase 6) (MAPK 6) (EC 2.7.11.24) (Extracellular signal-regulated kinase 3) (ERK-3) (MAP kinase isoform p97) (p97-MAPK) | EBI-12502733 | 0.35 |
| Q96FW1 | Ubiquitin thioesterase OTUB1 (EC 3.4.19.12) (Deubiquitinating enzyme OTUB1) (OTU domain-containing ubiquitin aldehyde-binding protein 1) (Otubain-1) (hOTU1) (Ubiquitin-specific-processing protease OTUB1) | EBI-10770198 | 0.35 |
| Q9CS74 | Protein ecdysoneless homolog | EBI-11150651 | 0.35 |
| Q9P0N5 | Transmembrane protein 216 | EBI-11398030 | 0.27 |
| Q9NUX5 | Protection of telomeres protein 1 (hPot1) (POT1-like telomere end-binding protein) | EBI-11304963 | 0.51 |
| Q6P5F9 | Exportin-1 (Exp1) (Chromosome region maintenance 1 protein homolog) | EBI-11603310 | 0.35 |
| P10827 | Thyroid hormone receptor alpha (Nuclear receptor subfamily 1 group A member 1) (V-erbA-related protein 7) (EAR-7) (c-erbA-1) (c-erbA-alpha) | EBI-24380444 | 0.56 |
| O14798 | Tumor necrosis factor receptor superfamily member 10C (Antagonist decoy receptor for TRAIL/Apo-2L) (Decoy TRAIL receptor without death domain) (Decoy receptor 1) (DcR1) (Lymphocyte inhibitor of TRAIL) (TNF-related apoptosis-inducing ligand receptor 3) (TRAIL receptor 3) (TRAIL-R3) (TRAIL receptor without an intracellular domain) (CD antigen CD263) | EBI-24707651 | 0.56 |
| P30301 | Lens fiber major intrinsic protein (Aquaporin-0) (MIP26) (MP26) | EBI-24712218 | 0.56 |
| O95159 | Zinc finger protein-like 1 (Zinc finger protein MCG4) | EBI-24729358 | 0.56 |
| Q15848 | Adiponectin (30 kDa adipocyte complement-related protein) (Adipocyte complement-related 30 kDa protein) (ACRP30) (Adipocyte, C1q and collagen domain-containing protein) (Adipose most abundant gene transcript 1 protein) (apM-1) (Gelatin-binding protein) | EBI-24739002 | 0.56 |
| Q8WVK2 | U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein (U4/U6.U5 snRNP 27 kDa protein) (U4/U6.U5-27K) (Nucleic acid-binding protein RY-1) (U4/U6.U5 tri-snRNP-associated 27 kDa protein) (27K) (U4/U6.U5 tri-snRNP-associated protein 3) | EBI-21500567 | 0.35 |
| P02675 | Fibrinogen beta chain [Cleaved into: Fibrinopeptide B; Fibrinogen beta chain] | EBI-21646531 | 0.35 |
| P05120 | Plasminogen activator inhibitor 2 (PAI-2) (Monocyte Arg-serpin) (Placental plasminogen activator inhibitor) (Serpin B2) (Urokinase inhibitor) | EBI-21713063 | 0.35 |
| P59536 | Taste receptor type 2 member 41 (T2R41) (Taste receptor type 2 member 59) (T2R59) | EBI-21736177 | 0.35 |
| Q96K76 | Ubiquitin carboxyl-terminal hydrolase 47 (EC 3.4.19.12) (Deubiquitinating enzyme 47) (Ubiquitin thioesterase 47) (Ubiquitin-specific-processing protease 47) | EBI-21756437 | 0.35 |
| Q9NY26 | Zinc transporter ZIP1 (Solute carrier family 39 member 1) (Zinc-iron-regulated transporter-like) (Zrt- and Irt-like protein 1) (ZIP-1) (hZIP1) | EBI-21772441 | 0.35 |
| P04798 | Cytochrome P450 1A1 (CYPIA1) (EC 1.14.14.1) (Cytochrome P450 form 6) (Cytochrome P450-C) (Cytochrome P450-P1) (Hydroperoxy icosatetraenoate dehydratase) (EC 4.2.1.152) | EBI-21774067 | 0.35 |
| Q13526 | Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 (EC 5.2.1.8) (Peptidyl-prolyl cis-trans isomerase Pin1) (PPIase Pin1) (Rotamase Pin1) | EBI-21884604 | 0.40 |
| O15155 | BET1 homolog (hBET1) (Golgi vesicular membrane-trafficking protein p18) | EBI-16788067 | 0.27 |
| P27824 | Calnexin (IP90) (Major histocompatibility complex class I antigen-binding protein p88) (p90) | EBI-16788621 | 0.27 |
| Q96I36 | Cytochrome c oxidase assembly protein COX14 | EBI-16791250 | 0.27 |
| P15311 | Ezrin (Cytovillin) (Villin-2) (p81) | EBI-16791848 | 0.27 |
| O14880 | Microsomal glutathione S-transferase 3 (Microsomal GST-3) (Glutathione peroxidase MGST3) (EC 1.11.1.-) (LTC4 synthase MGST3) (EC 4.4.1.20) (Microsomal glutathione S-transferase III) (Microsomal GST-III) | EBI-16796348 | 0.27 |
| Q9HBL7 | Plasminogen receptor (KT) (Plg-R(KT)) | EBI-16797429 | 0.27 |
| O75880 | Protein SCO1 homolog, mitochondrial | EBI-16799233 | 0.27 |
| Q9H9B4 | Sideroflexin-1 | EBI-16799442 | 0.27 |
| O43493 | Trans-Golgi network integral membrane protein 2 (Trans-Golgi network glycoprotein 46) (TGN38 homolog) (hTGN46) (Trans-Golgi network glycoprotein 48) (hTGN48) (Trans-Golgi network glycoprotein 51) (hTGN51) (Trans-Golgi network protein 2) | EBI-16800265 | 0.27 |
| Q15388 | Mitochondrial import receptor subunit TOM20 homolog (Mitochondrial 20 kDa outer membrane protein) (Outer mitochondrial membrane receptor Tom20) | EBI-16801791 | 0.27 |
| Q9NS69 | Mitochondrial import receptor subunit TOM22 homolog (hTom22) (1C9-2) (Translocase of outer membrane 22 kDa subunit homolog) | EBI-16802054 | 0.27 |
| Q9C0B5 | Palmitoyltransferase ZDHHC5 (EC 2.3.1.225) (Zinc finger DHHC domain-containing protein 5) (DHHC-5) (Zinc finger protein 375) | EBI-25637382 | 0.35 |
| Q2TAZ0 | Autophagy-related protein 2 homolog A | EBI-26443127 | 0.35 |
| Q99608 | Necdin | EBI-26955093 | 0.47 |
| P01116 | GTPase KRas (EC 3.6.5.2) (K-Ras 2) (Ki-Ras) (c-K-ras) (c-Ki-ras) [Cleaved into: GTPase KRas, N-terminally processed] | EBI-27041844 | 0.27 |
| P01111 | GTPase NRas (EC 3.6.5.2) (Transforming protein N-Ras) | EBI-27042293 | 0.27 |
| F1PAA9 | Cadherin-1 (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) [Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3] | EBI-27079701 | 0.27 |
| A0A0H3NB75 | Pathogenicity island 2 effector protein SseG (Type III secretion system effector protein-modulates the positioning of the SCV) | EBI-27055983 | 0.27 |
| Q9UM73 | ALK tyrosine kinase receptor (EC 2.7.10.1) (Anaplastic lymphoma kinase) (CD antigen CD246) | EBI-32719830 | 0.27 |
| P29322 | Ephrin type-A receptor 8 (EC 2.7.10.1) (EPH- and ELK-related kinase) (EPH-like kinase 3) (EK3) (hEK3) (Tyrosine-protein kinase receptor EEK) | EBI-32721175 | 0.27 |
| P11362 | Fibroblast growth factor receptor 1 (FGFR-1) (EC 2.7.10.1) (Basic fibroblast growth factor receptor 1) (BFGFR) (bFGF-R-1) (Fms-like tyrosine kinase 2) (FLT-2) (N-sam) (Proto-oncogene c-Fgr) (CD antigen CD331) | EBI-32721578 | 0.27 |
| P22607 | Fibroblast growth factor receptor 3 (FGFR-3) (EC 2.7.10.1) (CD antigen CD333) | EBI-32721979 | 0.27 |
| P22455 | Fibroblast growth factor receptor 4 (FGFR-4) (EC 2.7.10.1) (CD antigen CD334) | EBI-32722168 | 0.27 |
| P08069 | Insulin-like growth factor 1 receptor (EC 2.7.10.1) (Insulin-like growth factor I receptor) (IGF-I receptor) (CD antigen CD221) [Cleaved into: Insulin-like growth factor 1 receptor alpha chain; Insulin-like growth factor 1 receptor beta chain] | EBI-32722947 | 0.27 |
| P06213 | Insulin receptor (IR) (EC 2.7.10.1) (CD antigen CD220) [Cleaved into: Insulin receptor subunit alpha; Insulin receptor subunit beta] | EBI-32723092 | 0.27 |
| Q06124 | Tyrosine-protein phosphatase non-receptor type 11 (EC 3.1.3.48) (Protein-tyrosine phosphatase 1D) (PTP-1D) (Protein-tyrosine phosphatase 2C) (PTP-2C) (SH-PTP2) (SHP-2) (Shp2) (SH-PTP3) | EBI-32723738 | 0.27 |
| Q16288 | NT-3 growth factor receptor (EC 2.7.10.1) (GP145-TrkC) (Trk-C) (Neurotrophic tyrosine kinase receptor type 3) (TrkC tyrosine kinase) | EBI-32724526 | 0.27 |
| P07949 | Proto-oncogene tyrosine-protein kinase receptor Ret (EC 2.7.10.1) (Cadherin family member 12) (Proto-oncogene c-Ret) [Cleaved into: Soluble RET kinase fragment; Extracellular cell-membrane anchored RET cadherin 120 kDa fragment] | EBI-32725031 | 0.27 |
Database | Links |
| UNIPROT | Q96A49 Q68CP1 Q96C60 Q96JQ6 Q96T20 |
| PDB | 1X3A |
| Pfam | PF03909 |
| PROSITE | PS50858 |
National and Kapodistrian University of Athens
Department of Biology
Biophysics & Bioinformatics Laboratory