Nuclear envelope pore membrane protein POM 121 - Homo sapiens

Nuclear envelope pore membrane protein POM 121 (Homo sapiens)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	Nuclear envelope pore membrane protein POM 121
Accession Code	Q96HA1
Gene	POM121
Organism	Homo sapiens \| Human (Taxonomy: 9606)
Part of Reference Proteome?	Yes
Sequence (Length: 1249)
MSPAAAAAGAGERRRPIASVRDGRGRGCGGPARAVLLGLSLVGLLLYLVPAAAALAWLTVGATAAWWGLSREPRGSRPLS SFVRKARHRRPLSSFVRKARHRRTLFASPLAKSTANGNLLEPRTLLEGPDPAELLLMGSYLGKPGPPQPAAAPEGQDLRD RPGRRPPARPAPRSPPPRSPPPRSPPPSPPTHRAHHVYPSLPTPLLRPSRRPSPRDCGTLPNRFVITPRRRYPIHQAQYS CLGVLPTVCWNGYHKKAVLSPRNSRMVCSPVTVRIAPPDRRFSRSAIPEQIISSTLSSPSSNAPDPCAKETVLSALKEKE KKRTVEEEDQIFLDGQENKRRRHDSSGSGHSAFEPLVANGVPASFVPKPGSLKRGLNSQSSDDHLNKRSRSSSMSSLTGA YASGIPSSSRNAITSSYSSTRGISQLWKRNGPSSSPFSSPASSRSQTPERPAKKIREEELCHHSSSSTPLAADRESQGEK AADTTPRKKQNSNSQSTPGSSGQRKRKVQLLPSRRGEQLTLPPPPQLGYSITAEDLDLEKKASLQWFNQALEDKSDAASN SVTETPPITQPSFTFTLPAAAPASPPTSLLAPSTNPLLESLKKMQTPPSLPPCPESAGAATTEALSPPKTPSLLPPLGLS QSGPPGLLPSPSFDSKPPTTLLGLIPAPSMVPATDTKAPPTLQAETATKPQATSAPSPAPKQSFLFGTQNTSPSSPAAPA ASSAPPMFKPIFTAPPKSEKEGPTPPGPSVTATAPSSSSLPTTTSTTAPTFQPVFSSMGPPASVPLPAPFFKQTTTPATA PTTTAPLFTGLASATSAVAPITSASPSTDSASKPAFGFGINSVSSSSVSTTTSTATAASQPFLFGAPQASAASFTPAMGS IFQFGKPPALPTTTTVTTFSQSLHTAVPTATSSSAADFSGFGSTLATSAPATSSQPTLTFSNTSTPTFNIPFGSSAKSPL PSYPGANPQPAFGAAEGQPPGAAKPALAPSFGSSFTFGNSAAPAAAPTPAPPSMIKVVPAYVPTPIHPIFGGATHSAFGL KATASAFGAPASSQPAFGGSTAVFFGAATSSGFGATTQTASSGSSSSVFGSTTPSPFTFGGSAAPAGSGSFGINVATPGS STTTGAFSFGAGQSGSTATSTPFAGGLGQNALGTTGQSTPFAFNVSSTTESKPVFGGTATPTFGLNTPAPGVGTSGSSLS FGASSAPAQGFVGVAPFGSAALSFSIGAGSKTPGARQRLQARRQHTRKK

Structure Viewer (PDB: 5T6W)

Subcellular Location

Description
Nucleus, nuclear pore complex {Experimental EvidencePubMed:17900573}. Nucleus membrane {Experimental EvidencePubMed:17900573}; Single-pass membrane protein {Experimental EvidencePubMed:17900573}. Endoplasmic reticulum membrane {ECO:0000250}; Single-pass membrane protein {ECO:0000250}. Note=Stably associated with the NPC throughout interphase and the endoplasmic reticulum during metaphase. {ECO:0000250}.
Position in the Nuclear Envelope
Location	Location ID	Description
Nuclear Envelope	SL-0178	The nuclear envelope is a membrane system which surrounds the nucleoplasm of eukaryotic cells. It is composed of the nuclear lamina, nuclear pore complexes and two nuclear membranes. The space between the two membranes is called the nuclear intermembrane space.
Nuclear Membrane	SL-0182	The membrane surrounding the nucleus. This term is used when it is not known if the protein is found in or associated with the inner or outer nuclear membrane.
Nuclear Pore Complex	SL-0185	The nuclear pore complex (NPC) constitutes the exclusive means of nucleocytoplasmic transport. NPCs allow the passive diffusion of ions and small molecules and the active bidirectional transport of macromolecules such as proteins, RNAs etc across the double-membrane nuclear envelope.The NPC is composed of at least 30 distinct subunits known as Nucleoporins (NUPs).
Membrane Topology
Topology	Source	Annotation Type
Transmembrane	UniProt	Sequence Analysis {ECO:0000255}
Assigned Ontology terms

Cellular Component	Endoplasmic Reticulum Membrane (GO:0005789) Nuclear Envelope (GO:0005635) Nuclear Membrane (GO:0031965) Nuclear Pore (GO:0005643) Nucleoplasm (GO:0005654)

Biology & Function

Description
Essential component of the nuclear pore complex (NPC). The repeat-containing domain may be involved in anchoring components of the pore complex to the pore membrane. When overexpressed in cells induces the formation of cytoplasmic annulate lamellae (AL). {Experimental EvidencePubMed:17900573}.
Assigned Ontology terms

Biological Process	MRNA Transport (GO:0051028) Nucleocytoplasmic Transport (GO:0006913) Protein Import Into Nucleus (GO:0006606) RNA Export From Nucleus (GO:0006405)
Molecular Function	Nuclear Localization Sequence Binding (GO:0008139) Structural Constituent Of Nuclear Pore (GO:0017056)

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (8 interactors)

Partner (NucEnvDB)		IntAct	Confidence score
P55735	Protein SEC13 homolog	EBI-11889618	0.37
Q8WYP5	Protein ELYS	EBI-9050350	0.40
A1KXE4	Myelin-associated neurite-outgrowth inhibitor	EBI-24715141	0.56
Q14974	Importin subunit beta-1	EBI-30827588	0.44
P02545	Lamin-A/C	EBI-16795756	0.27
O60711	Leupaxin	EBI-24358856	0.56
P49790	Nuclear pore complex protein Nup153	EBI-11076796	0.35
Q7Z3B4	Nucleoporin p54	EBI-11889100	0.37
Interactions with other proteins (79 interactors)

Partner (UniProt)		IntAct	Confidence score
Q9Y5P4	Ceramide transfer protein (hCERT) (Collagen type IV alpha-3-binding protein) (Goodpasture antigen-binding protein) (GPBP) (START domain-containing protein 11) (StARD11) (StAR-related lipid transfer protein 11)	EBI-752566	0.37
O95994	Anterior gradient protein 2 homolog (AG-2) (hAG-2) (HPC8) (Secreted cement gland protein XAG-2 homolog)	EBI-752794	0.67
Q15654	Thyroid receptor-interacting protein 6 (TR-interacting protein 6) (TRIP-6) (Opa-interacting protein 1) (OIP-1) (Zyxin-related protein 1) (ZRP-1)	EBI-24332278	0.56
P46976	Glycogenin-1 (GN-1) (GN1) (EC 2.4.1.186)	EBI-754300	0.37
P36406	E3 ubiquitin-protein ligase TRIM23 (EC 2.3.2.27) (ADP-ribosylation factor domain-containing protein 1) (GTP-binding protein ARD-1) (RING finger protein 46) (RING-type E3 ubiquitin transferase TRIM23) (Tripartite motif-containing protein 23)	EBI-24306440	0.56
Q53EZ4	Centrosomal protein of 55 kDa (Cep55) (Up-regulated in colon cancer 6)	EBI-756040	0.37
P63010	AP-2 complex subunit beta (AP105B) (Adaptor protein complex AP-2 subunit beta) (Adaptor-related protein complex 2 subunit beta) (Beta-2-adaptin) (Beta-adaptin) (Clathrin assembly protein complex 2 beta large chain) (Plasma membrane adaptor HA2/AP2 adaptin beta subunit)	EBI-24498237	0.56
P14136	Glial fibrillary acidic protein (GFAP)	EBI-757885	0.37
Q8IYF3	Testis-expressed protein 11 (Protein ZIP4 homolog) (ZIP4H)	EBI-758542	0.67
P25963	NF-kappa-B inhibitor alpha (I-kappa-B-alpha) (IkB-alpha) (IkappaBalpha) (Major histocompatibility complex enhancer-binding protein MAD3)	EBI-24355218	0.56
Q08379	Golgin subfamily A member 2 (130 kDa cis-Golgi matrix protein) (GM130) (GM130 autoantigen) (Golgin-95)	EBI-25252899	0.56
Q93062	RNA-binding protein with multiple splicing (RBP-MS) (Heart and RRM expressed sequence) (Hermes)	EBI-759391	0.67
P54253	Ataxin-1 (Spinocerebellar ataxia type 1 protein)	EBI-25981994	0.56
P69961	Low calcium response locus protein S	EBI-2861010	0.00
Q8D014	Ribonucleoside-diphosphate reductase (EC 1.17.4.1)	EBI-2861003	0.00
Q92731	Estrogen receptor beta (ER-beta) (Nuclear receptor subfamily 3 group A member 2)	EBI-2880211	0.35
P25054	Adenomatous polyposis coli protein (Protein APC) (Deleted in polyposis 2.5)	EBI-3437412	0.00
P51116	RNA-binding protein FXR2 (FMR1 autosomal homolog 2)	EBI-8637014	0.67
Q05322	Membrane-associated protein VP24 (Ebola VP24) (eVP24)	EBI-6159823	0.35
Q9NSC5	Homer protein homolog 3 (Homer-3)	EBI-10287122	0.56
Q6ZW49	PAX-interacting protein 1 (PAX transactivation activation domain-interacting protein)	EBI-10287154	0.56
Q8TAP6	Centrosomal protein of 76 kDa (Cep76)	EBI-10287176	0.56
P42262	Glutamate receptor 2 (GluR-2) (AMPA-selective glutamate receptor 2) (GluR-B) (GluR-K2) (Glutamate receptor ionotropic, AMPA 2) (GluA2)	EBI-11041024	0.35
Q8VE37	Regulator of chromosome condensation (Chromosome condensation protein 1)	EBI-11043815	0.35
Q8CI51	PDZ and LIM domain protein 5 (Enigma homolog) (Enigma-like PDZ and LIM domains protein)	EBI-11124806	0.35
P03496	Non-structural protein 1 (NS1) (NS1A)	EBI-11519933	0.37
Q2PJP0	Non-structural protein 1 (NS1)	EBI-11520513	0.37
P03508	Nuclear export protein (NEP) (Non-structural protein 2) (NS2)	EBI-11520975	0.37
Q20MH4	Nuclear export protein (NEP) (Non-structural protein 2) (NS2)	EBI-11521180	0.37
Q0A2H1	Nuclear export protein (NEP) (Non-structural protein 2) (NS2)	EBI-11521369	0.37
Q2PJP1	Nuclear export protein (NEP) (Non-structural protein 2) (NS2)	EBI-11521569	0.37
Q6DP94	Nuclear export protein (NEP) (Non-structural protein 2) (NS2)	EBI-11521763	0.37
Q9Y5V3	Melanoma-associated antigen D1 (MAGE tumor antigen CCF) (MAGE-D1 antigen) (Neurotrophin receptor-interacting MAGE homolog)	EBI-24285600	0.56
P14373	Zinc finger protein RFP (EC 2.3.2.27) (RING finger protein 76) (RING-type E3 ubiquitin transferase TRIM27) (Ret finger protein) (Tripartite motif-containing protein 27)	EBI-24287635	0.56
Q9UHD9	Ubiquilin-2 (Chap1) (DSK2 homolog) (Protein linking IAP with cytoskeleton 2) (PLIC-2) (hPLIC-2) (Ubiquitin-like product Chap1/Dsk2)	EBI-24294799	0.56
Q96R06	Sperm-associated antigen 5 (Astrin) (Deepest) (Mitotic spindle-associated protein p126) (MAP126)	EBI-24364662	0.56
Q9UBB9	Tuftelin-interacting protein 11 (Septin and tuftelin-interacting protein 1) (STIP-1)	EBI-24486689	0.56
Q8N9W6	Protein boule-like	EBI-24500998	0.56
Q9H0C1	Zinc finger MYND domain-containing protein 12	EBI-24506831	0.56
Q9Y2V7	Conserved oligomeric Golgi complex subunit 6 (COG complex subunit 6) (Component of oligomeric Golgi complex 6)	EBI-24507828	0.56
P40199	Carcinoembryonic antigen-related cell adhesion molecule 6 (Non-specific crossreacting antigen) (Normal cross-reacting antigen) (CD antigen CD66c)	EBI-24532782	0.56
P40763	Signal transducer and activator of transcription 3 (Acute-phase response factor)	EBI-24614960	0.56
Q5VZ52	MORN repeat-containing protein 5	EBI-24772111	0.56
P0CI25	Tripartite motif-containing protein 49 (RING finger protein 18) (Testis-specific RING-finger protein)	EBI-24374702	0.56
Q13114	TNF receptor-associated factor 3 (EC 2.3.2.27) (CD40 receptor-associated factor 1) (CRAF1) (CD40-binding protein) (CD40BP) (LMP1-associated protein 1) (LAP1) (RING-type E3 ubiquitin transferase TRAF3)	EBI-24413959	0.56
Q7L8S5	OTU domain-containing protein 6A (EC 3.4.19.12) (DUBA-2)	EBI-24426023	0.56
O60684	Importin subunit alpha-7 (Karyopherin subunit alpha-6)	EBI-24426816	0.56
Q2TAC2	Coiled-coil domain-containing protein 57	EBI-24449313	0.56
Q10567	AP-1 complex subunit beta-1 (Adaptor protein complex AP-1 subunit beta-1) (Adaptor-related protein complex 1 subunit beta-1) (Beta-1-adaptin) (Beta-adaptin 1) (Clathrin assembly protein complex 1 beta large chain) (Golgi adaptor HA1/AP1 adaptin beta subunit)	EBI-24463567	0.56
Q12933	TNF receptor-associated factor 2 (EC 2.3.2.27) (E3 ubiquitin-protein ligase TRAF2) (RING-type E3 ubiquitin transferase TRAF2) (Tumor necrosis factor type 2 receptor-associated protein 3)	EBI-24474317	0.56
P0C870	Bifunctional peptidase and (3S)-lysyl hydroxylase JMJD7 (EC 1.14.11.63) (EC 3.4.-.-) (JmjC domain-containing protein 7) (Jumonji domain-containing protein 7) (L-lysine (3S)-hydroxylase JMJD7)	EBI-24592839	0.56
Q9Y4F3	Meiosis regulator and mRNA stability factor 1 (Limkain-b1) (Meiosis arrest female protein 1)	EBI-11926683	0.00
Q504Q3	PAN2-PAN3 deadenylation complex catalytic subunit PAN2 (EC 3.1.13.4) (Inactive ubiquitin carboxyl-terminal hydrolase 52) (PAB1P-dependent poly(A)-specific ribonuclease) (Poly(A)-nuclease deadenylation complex subunit 2) (PAN deadenylation complex subunit 2)	EBI-11926674	0.00
Q2M3V2	Ankyrin repeat domain-containing protein SOWAHA (Ankyrin repeat domain-containing protein 43) (Protein sosondowah homolog A)	EBI-11926665	0.00
P42694	Probable helicase with zinc finger domain (EC 3.6.4.-) (Down-regulated in human cancers protein)	EBI-11926656	0.00
D0UZL9	K3	EBI-14061866	0.40
A4D1S0	Killer cell lectin-like receptor subfamily G member 2 (C-type lectin domain family 15 member B)	EBI-21511461	0.35
P20036	HLA class II histocompatibility antigen, DP alpha 1 chain (DP(W3)) (DP(W4)) (HLA-SB alpha chain) (MHC class II DP3-alpha) (MHC class II DPA1)	EBI-21511890	0.35
Q9UGM1	Neuronal acetylcholine receptor subunit alpha-9 (Nicotinic acetylcholine receptor subunit alpha-9) (NACHR alpha-9)	EBI-21517134	0.35
O15482	Testis-specific protein TEX28	EBI-21523851	0.35
P55345	Protein arginine N-methyltransferase 2 (EC 2.1.1.319) (Histone-arginine N-methyltransferase PRMT2)	EBI-21544312	0.35
Q96JJ6	Junctophilin-4 (JP-4) (Junctophilin-like 1 protein)	EBI-21570881	0.35
Q504Y0	Zinc transporter ZIP12 (LIV-1 subfamily of ZIP zinc transporter 8) (LZT-Hs8) (Solute carrier family 39 member 12) (Zrt- and Irt-like protein 12) (ZIP-12)	EBI-21572157	0.35
P36941	Tumor necrosis factor receptor superfamily member 3 (Lymphotoxin-beta receptor) (Tumor necrosis factor C receptor) (Tumor necrosis factor receptor 2-related protein) (Tumor necrosis factor receptor type III) (TNF-RIII) (TNFR-III)	EBI-21581171	0.35
O43291	Kunitz-type protease inhibitor 2 (Hepatocyte growth factor activator inhibitor type 2) (HAI-2) (Placental bikunin)	EBI-21587968	0.35
Q8WWF5	E3 ubiquitin-protein ligase ZNRF4 (EC 2.3.2.27) (Nixin) (RING finger protein 204) (RING-type E3 ubiquitin transferase ZNRF4) (Zinc/RING finger protein 4)	EBI-21589535	0.35
Q9NRJ7	Protocadherin beta-16 (PCDH-beta-16) (Protocadherin-3X)	EBI-21590428	0.35
O14595	Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 2 (EC 3.1.3.16) (Nuclear LIM interactor-interacting factor 2) (NLI-interacting factor 2) (Protein OS-4) (Small C-terminal domain phosphatase 2) (Small CTD phosphatase 2) (SCP2)	EBI-21619731	0.35
P33151	Cadherin-5 (7B4 antigen) (Vascular endothelial cadherin) (VE-cadherin) (CD antigen CD144)	EBI-21650356	0.35
Q8IV45	UNC5C-like protein (Protein unc-5 homolog C-like) (ZU5 and death domain-containing protein)	EBI-21699883	0.35
Q6UXL0	Interleukin-20 receptor subunit beta (IL-20 receptor subunit beta) (IL-20R-beta) (IL-20RB) (Fibronectin type III domain containing 6) (FNDC6) (IL-20R2)	EBI-21748090	0.35
Q96G97	Seipin (Bernardinelli-Seip congenital lipodystrophy type 2 protein)	EBI-21755399	0.35
Q9UN86	Ras GTPase-activating protein-binding protein 2 (G3BP-2) (GAP SH3 domain-binding protein 2)	EBI-21866171	0.35
Q9UI95	Mitotic spindle assembly checkpoint protein MAD2B (Mitotic arrest deficient 2-like protein 2) (MAD2-like protein 2) (REV7 homolog) (hREV7)	EBI-20219138	0.35
Q13627	Dual specificity tyrosine-phosphorylation-regulated kinase 1A (EC 2.7.11.23) (EC 2.7.12.1) (Dual specificity YAK1-related kinase) (HP86) (Protein kinase minibrain homolog) (MNBH) (hMNB)	EBI-26367331	0.35
Q8NCK7	Monocarboxylate transporter 11 (MCT 11) (Solute carrier family 16 member 11)	EBI-27103180	0.35
P46934	E3 ubiquitin-protein ligase NEDD4 (EC 2.3.2.26) (Cell proliferation-inducing gene 53 protein) (HECT-type E3 ubiquitin transferase NEDD4) (Neural precursor cell expressed developmentally down-regulated protein 4) (NEDD-4)	EBI-30833846	0.44
Q93009	Ubiquitin carboxyl-terminal hydrolase 7 (EC 3.4.19.12) (Deubiquitinating enzyme 7) (Herpesvirus-associated ubiquitin-specific protease) (Ubiquitin thioesterase 7) (Ubiquitin-specific-processing protease 7)	EBI-30844051	0.44
P46937	Transcriptional coactivator YAP1 (Yes-associated protein 1) (Protein yorkie homolog) (Yes-associated protein YAP65 homolog)	EBI-30848026	0.44

Cross-References

Database	Links
UNIPROT	Q96HA1 A6NFS9 A8CDT4 A8K933 A8MXF9 O75115 Q96DI0 Q9H9X1 Q9Y2N3 Q9Y4S7
PDB	5T6W
OMIM	615753
DisGeNET	9883

Nuclear envelope pore membrane protein POM 121 (Homo sapiens)

General Information

Protein Information

Structure Viewer (PDB: 5T6W)

Subcellular Location

Description Show

Position in the Nuclear Envelope

Membrane Topology

Assigned Ontology terms

Biology & Function

Description Hide

Assigned Ontology terms

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (8 interactors)

Interactions with other proteins (79 interactors)

Cross-References

Database

Links

Description

Description