Protein Information |
|
|---|---|
| Protein Name | Importin subunit beta-1 |
| Accession Code | Q14974 |
| Gene | KPNB1 |
| Organism | Homo sapiens | Human (Taxonomy: 9606) |
| Part of Reference Proteome? | Yes |
| Sequence (Length: 876) | |
|
MELITILEKTVSPDRLELEAAQKFLERAAVENLPTFLVELSRVLANPGNSQVARVAAGLQIKNSLTSKDPDIKAQYQQRW LAIDANARREVKNYVLQTLGTETYRPSSASQCVAGIACAEIPVNQWPELIPQLVANVTNPNSTEHMKESTLEAIGYICQD IDPEQLQDKSNEILTAIIQGMRKEEPSNNVKLAATNALLNSLEFTKANFDKESERHFIMQVVCEATQCPDTRVRVAALQN LVKIMSLYYQYMETYMGPALFAITIEAMKSDIDEVALQGIEFWSNVCDEEMDLAIEASEAAEQGRPPEHTSKFYAKGALQ YLVPILTQTLTKQDENDDDDDWNPCKAAGVCLMLLATCCEDDIVPHVLPFIKEHIKNPDWRYRDAAVMAFGCILEGPEPS QLKPLVIQAMPTLIELMKDPSVVVRDTAAWTVGRICELLPEAAINDVYLAPLLQCLIEGLSAEPRVASNVCWAFSSLAEA AYEAADVADDQEEPATYCLSSSFELIVQKLLETTDRPDGHQNNLRSSAYESLMEIVKNSAKDCYPAVQKTTLVIMERLQQ VLQMESHIQSTSDRIQFNDLQSLLCATLQNVLRKVQHQDALQISDVVMASLLRMFQSTAGSGGVQEDALMAVSTLVEVLG GEFLKYMEAFKPFLGIGLKNYAEYQVCLAAVGLVGDLCRALQSNIIPFCDEVMQLLLENLGNENVHRSVKPQILSVFGDI ALAIGGEFKKYLEVVLNTLQQASQAQVDKSDYDMVDYLNELRESCLEAYTGIVQGLKGDQENVHPDVMLVQPRVEFILSF IDHIAGDEDHTDGVVACAAGLIGDLCTAFGKDVLKLVEARPMIHELLTEGRRSKTNKAKTLATWATKELRKLKNQA |
|
Structure Viewer (PDB: 6N88) |
|---|
Description |
||
|---|---|---|
| Cytoplasm {Experimental EvidencePubMed:11891849}. Nucleus envelope {Experimental EvidencePubMed:11891849}. | Position in the Nuclear Envelope |
|
| Location | Location ID | Description |
| Nuclear Envelope | SL-0178 | The nuclear envelope is a membrane system which surrounds the nucleoplasm of eukaryotic cells. It is composed of the nuclear lamina, nuclear pore complexes and two nuclear membranes. The space between the two membranes is called the nuclear intermembrane space. | Membrane Topology |
| Topology | Source | Annotation Type |
| Unknown | UniProt | Sequence Analysis | Assigned Ontology terms |
| Cellular Component | Cytoplasm (GO:0005737) Cytoplasmic Stress Granule (GO:0010494) Cytosol (GO:0005829) Endoplasmic Reticulum Tubular Network (GO:0071782) Extracellular Exosome (GO:0070062) Extracellular Region (GO:0005576) Ficolin-1-Rich Granule Lumen (GO:1904813) Membrane (GO:0016020) NLS-Dependent Protein Nuclear Import Complex (GO:0042564) Nuclear Envelope (GO:0005635) Nuclear Membrane (GO:0031965) Nuclear Pore (GO:0005643) Nucleoplasm (GO:0005654) Nucleus (GO:0005634) Specific Granule Lumen (GO:0035580) |
|
Description |
|
|---|---|
| Functions in nuclear protein import, either in association with an adapter protein, like an importin-alpha subunit, which binds to nuclear localization signals (NLS) in cargo substrates, or by acting as autonomous nuclear transport receptor. Acting autonomously, serves itself as NLS receptor. Docking of the importin/substrate complex to the nuclear pore complex (NPC) is mediated by KPNB1 through binding to nucleoporin FxFG repeats and the complex is subsequently translocated through the pore by an energy requiring, Ran-dependent mechanism. At the nucleoplasmic side of the NPC, Ran binds to importin-beta and the three components separate and importin-alpha and -beta are re-exported from the nucleus to the cytoplasm where GTP hydrolysis releases Ran from importin. The directionality of nuclear import is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus. Mediates autonomously the nuclear import of ribosomal proteins RPL23A, RPS7 and RPL5 (PubMed:11682607). In association with IPO7, mediates the nuclear import of H1 histone. In vitro, mediates nuclear import of H2A, H2B, H3 and H4 histones. In case of HIV-1 infection, binds and mediates the nuclear import of HIV-1 Rev. Imports SNAI1 and PRKCI into the nucleus. {Experimental EvidencePubMed:10228156, Experimental EvidencePubMed:11682607, Experimental EvidencePubMed:11891849, Experimental EvidencePubMed:19386897, Experimental EvidencePubMed:24699649, Experimental EvidencePubMed:9687515}. | Assigned Ontology terms |
| Biological Process | Astral Microtubule Organization (GO:0030953) Establishment Of Mitotic Spindle Localization (GO:0040001) Establishment Of Protein Localization (GO:0045184) Mitotic Chromosome Movement Towards Spindle Pole (GO:0007079) Mitotic Metaphase Plate Congression (GO:0007080) Mitotic Spindle Assembly (GO:0090307) NLS-Bearing Protein Import Into Nucleus (GO:0006607) Protein Import Into Nucleus (GO:0006606) Ran Protein Signal Transduction (GO:0031291) Ribosomal Protein Import Into Nucleus (GO:0006610) RNA Import Into Nucleus (GO:0006404) |
| Molecular Function | Enzyme Binding (GO:0019899) Hsp90 Protein Binding (GO:0051879) Importin-Alpha Family Protein Binding (GO:0061676) Nuclear Import Signal Receptor Activity (GO:0061608) Nuclear Localization Sequence Binding (GO:0008139) Protein Domain Specific Binding (GO:0019904) RNA Binding (GO:0003723) Small GTPase Binding (GO:0031267) Zinc Ion Binding (GO:0008270) |
Interactions with Nuclear Envelope proteins (51 interactors) |
|||
|---|---|---|---|
| Partner (NucEnvDB) | IntAct | Confidence score | |
| A0A142I5B9 | RNA-directed RNA polymerase NS5 | EBI-20625330 | 0.35 |
| A6NF01 | Putative nuclear envelope pore membrane protein POM 121B | EBI-30827108 | 0.44 |
| A8CG34 | Nuclear envelope pore membrane protein POM 121C | EBI-11115566 | 0.59 |
| O14524 | Nuclear envelope integral membrane protein 1 | EBI-11115566 | 0.35 |
| O15504 | Nucleoporin NUP42 | EBI-11115566 | 0.35 |
| O95295 | SNARE-associated protein Snapin | EBI-5664409 | 0.00 |
| P02545 | Lamin-A/C | EBI-16795756 | 0.27 |
| P14907 | Nucleoporin NSP1 | EBI-1034546 | 0.62 |
| P35658 | Nuclear pore complex protein Nup214 | EBI-30827243 | 0.44 |
| P46060 | Ran GTPase-activating protein 1 | EBI-11115566 | 0.35 |
| P49790 | Nuclear pore complex protein Nup153 | EBI-11076796 | 0.77 |
| P49792 | E3 SUMO-protein ligase RanBP2 | EBI-11115566 | 0.35 |
| P52948 | Nuclear pore complex protein Nup96 | EBI-11115566 | 0.35 |
| P57740 | Nuclear pore complex protein Nup107 | EBI-11115566 | 0.35 |
| P62826 | GTP-binding nuclear protein Ran | EBI-11115566 | 0.53 |
| P63165 | Small ubiquitin-related modifier 1 | EBI-11115566 | 0.35 |
| P63279 | SUMO-conjugating enzyme UBC9 | EBI-11105225 | 0.35 |
| P70168 | Importin subunit beta-1 | EBI-2555147 | 0.40 |
| P78406 | mRNA export factor RAE1 | EBI-11115566 | 0.35 |
| Q12769 | Nuclear pore complex protein Nup160 | EBI-11115566 | 0.35 |
| Q9ERU9 | E3 SUMO-protein ligase RanBP2 | EBI-2555617 | 0.56 |
| Q14974 | Self | EBI-7166773 | 0.44 |
| Q9UH99 | SUN domain-containing protein 2 | EBI-8021405 | 0.40 |
| Q6PFD9 | Nuclear pore complex protein Nup96 | EBI-10994876 | 0.35 |
| Q8BH74 | Nuclear pore complex protein Nup107 | EBI-10997196 | 0.35 |
| Q5SRE5 | Nucleoporin NUP188 | EBI-11115566 | 0.35 |
| Q8WUM0 | Nuclear pore complex protein Nup133 | EBI-11115566 | 0.35 |
| Q96EE3 | Nucleoporin SEH1 | EBI-11115566 | 0.35 |
| Q92621 | Nuclear pore complex protein Nup205 | EBI-11115566 | 0.35 |
| Q8NFH5 | Nucleoporin NUP35 | EBI-11115566 | 0.35 |
| Q9UKX7 | Nuclear pore complex protein Nup50 | EBI-11115566 | 0.35 |
| Q8N1F7 | Nuclear pore complex protein Nup93 | EBI-11115566 | 0.35 |
| Q9NXE4 | Sphingomyelin phosphodiesterase 4 | EBI-11115566 | 0.35 |
| Q8NFH4 | Nucleoporin Nup37 | EBI-11115566 | 0.35 |
| Q8NFH3 | Nucleoporin Nup43 | EBI-11115566 | 0.35 |
| Q8TEM1 | Nuclear pore membrane glycoprotein 210 | EBI-11115566 | 0.35 |
| Q9BTX1 | Nucleoporin NDC1 | EBI-11115566 | 0.35 |
| Q99567 | Nuclear pore complex protein Nup88 | EBI-11115566 | 0.35 |
| Q9UBU9 | Nuclear RNA export factor 1 | EBI-11115566 | 0.35 |
| Q9BW27 | Nuclear pore complex protein Nup85 | EBI-11115566 | 0.35 |
| Q9WMX2 | RNA-directed RNA polymerase | EBI-11513409 | 0.50 |
| Q96HA1 | Nuclear envelope pore membrane protein POM 121 | EBI-30827588 | 0.44 |
| Q9NRG9 | Aladin | EBI-11115566 | 0.35 |
| Q9R1K9 | Centrin-2 | EBI-11111151 | 0.35 |
| Q15642 | Cdc42-interacting protein 4 | EBI-30827298 | 0.44 |
| Q92905 | COP9 signalosome complex subunit 5 | EBI-21325777 | 0.35 |
| Q9UPY3 | Endoribonuclease Dicer | EBI-20621330 | 0.35 |
| P00533 | Epidermal growth factor receptor | EBI-702075 | 0.35 |
| P04626 | Receptor tyrosine-protein kinase erbB-2 | EBI-4373084 | 0.57 |
| Q53GS7 | mRNA export factor GLE1 | EBI-11115566 | 0.35 |
| Q02821 | Importin subunit alpha | EBI-13942487 | 0.44 | Interactions with other proteins (213 interactors) |
| Partner (UniProt) | IntAct | Confidence score | |
| P52292 | Importin subunit alpha-1 (Karyopherin subunit alpha-2) (RAG cohort protein 1) (SRP1-alpha) | EBI-286795 | 0.93 |
| Q9GK30 | Parathyroid hormone-related protein (PTH-rP) (PTHrP) | EBI-8580826 | 0.44 |
| Q9NRA8 | Eukaryotic translation initiation factor 4E transporter (4E-T) (eIF4E transporter) (Eukaryotic translation initiation factor 4E nuclear import factor 1) | EBI-301394 | 0.35 |
| Q01201 | Transcription factor RelB (I-Rel) | EBI-363445 | 0.00 |
| P20333 | Tumor necrosis factor receptor superfamily member 1B (Tumor necrosis factor receptor 2) (TNF-R2) (Tumor necrosis factor receptor type II) (TNF-RII) (TNFR-II) (p75) (p80 TNF-alpha receptor) (CD antigen CD120b) (Etanercept) [Cleaved into: Tumor necrosis factor receptor superfamily member 1b, membrane form; Tumor necrosis factor-binding protein 2 (TBP-2) (TBPII)] | EBI-364543 | 0.00 |
| Q15628 | Tumor necrosis factor receptor type 1-associated DEATH domain protein (TNFR1-associated DEATH domain protein) (TNFRSF1A-associated via death domain) | EBI-364816 | 0.00 |
| Q9Y4K3 | TNF receptor-associated factor 6 (EC 2.3.2.27) (E3 ubiquitin-protein ligase TRAF6) (Interleukin-1 signal transducer) (RING finger protein 85) (RING-type E3 ubiquitin transferase TRAF6) | EBI-365110 | 0.00 |
| P60709 | Actin, cytoplasmic 1 (EC 3.6.4.-) (Beta-actin) [Cleaved into: Actin, cytoplasmic 1, N-terminally processed] | EBI-353790 | 0.40 |
| Q16637 | Survival motor neuron protein (Component of gems 1) (Gemin-1) | EBI-464895 | 0.52 |
| O75940 | Survival of motor neuron-related-splicing factor 30 (30 kDa splicing factor SMNrp) (SMN-related protein) (Survival motor neuron domain-containing protein 1) | EBI-464916 | 0.40 |
| Q12873 | Chromodomain-helicase-DNA-binding protein 3 (CHD-3) (EC 3.6.4.12) (ATP-dependent helicase CHD3) (Mi-2 autoantigen 240 kDa protein) (Mi2-alpha) (Zinc finger helicase) (hZFH) | EBI-474956 | 0.37 |
| Q8N2W9 | E3 SUMO-protein ligase PIAS4 (EC 2.3.2.27) (PIASy) (Protein inhibitor of activated STAT protein 4) (Protein inhibitor of activated STAT protein gamma) (PIAS-gamma) | EBI-475005 | 0.37 |
| P21246 | Pleiotrophin (PTN) (Heparin-binding brain mitogen) (HBBM) (Heparin-binding growth factor 8) (HBGF-8) (Heparin-binding growth-associated molecule) (HB-GAM) (Heparin-binding neurite outgrowth-promoting factor) (HBNF) (Heparin-binding neurite outgrowth-promoting factor 1) (HBNF-1) (Osteoblast-specific factor 1) (OSF-1) | EBI-475012 | 0.37 |
| Q15796 | Mothers against decapentaplegic homolog 2 (MAD homolog 2) (Mothers against DPP homolog 2) (JV18-1) (Mad-related protein 2) (hMAD-2) (SMAD family member 2) (SMAD 2) (Smad2) (hSMAD2) | EBI-7224889 | 0.37 |
| P51178 | 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-1 (EC 3.1.4.11) (Phosphoinositide phospholipase C-delta-1) (Phospholipase C-III) (PLC-III) (Phospholipase C-delta-1) (PLC-delta-1) | EBI-7795361 | 0.60 |
| O92837 | Minor capsid protein | EBI-8512780 | 0.40 |
| P03087 | Major capsid protein VP1 (Major structural protein VP1) | EBI-8512862 | 0.44 |
| P03126 | Protein E6 | EBI-8592423 | 0.44 |
| P03107 | Minor capsid protein L2 | EBI-7362635 | 0.44 |
| P03101 | Major capsid protein L1 | EBI-7362692 | 0.62 |
| P63104 | 14-3-3 protein zeta/delta (Protein kinase C inhibitor protein 1) (KCIP-1) | EBI-7194971 | 0.40 |
| P13569 | Cystic fibrosis transmembrane conductance regulator (CFTR) (ATP-binding cassette sub-family C member 7) (Channel conductance-controlling ATPase) (EC 5.6.1.6) (cAMP-dependent chloride channel) | EBI-1171566 | 0.64 |
| P01106 | Myc proto-oncogene protein (Class E basic helix-loop-helix protein 39) (bHLHe39) (Proto-oncogene c-Myc) (Transcription factor p64) | EBI-1237540 | 0.35 |
| P32121 | Beta-arrestin-2 (Arrestin beta-2) (Non-visual arrestin-3) | EBI-1642843 | 0.35 |
| Q00005 | Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B beta isoform (PP2A subunit B isoform B55-beta) (PP2A subunit B isoform PR55-beta) (PP2A subunit B isoform R2-beta) (PP2A subunit B isoform beta) | EBI-2211497 | 0.35 |
| Q9Z0E3 | Autoimmune regulator (Autoimmune polyendocrinopathy candidiasis ectodermal dystrophy protein homolog) (APECED protein homolog) | EBI-2549710 | 0.35 |
| Q9QWT9 | Kinesin-like protein KIFC1 | EBI-2558911 | 0.40 |
| E9PVX6 | Proliferation marker protein Ki-67 (Antigen identified by monoclonal antibody Ki-67 homolog) (Antigen KI-67 homolog) (Antigen Ki67 homolog) | EBI-2561030 | 0.40 |
| Q9D4G9 | RecQ-mediated genome instability protein 1 | EBI-2561931 | 0.40 |
| Q9D0T1 | NHP2-like protein 1 (Fertilization antigen 1) (FA-1) (High mobility group-like nuclear protein 2 homolog 1) (Sperm-specific antigen 1) (U4/U6.U5 small nuclear ribonucleoprotein SNU13) (U4/U6.U5 tri-snRNP 15.5 kDa protein) [Cleaved into: NHP2-like protein 1, N-terminally processed] | EBI-2563541 | 0.40 |
| Q8N0X7 | Spartin (Spastic paraplegia 20 protein) (Trans-activated by hepatitis C virus core protein 1) | EBI-2643801 | 0.35 |
| Q5NEH1 | Carbamoyl-phosphate synthase large chain (EC 6.3.5.5) (Carbamoyl-phosphate synthetase ammonia chain) | EBI-2805872 | 0.00 |
| Q13573 | SNW domain-containing protein 1 (Nuclear protein SkiP) (Nuclear receptor coactivator NCoA-62) (Ski-interacting protein) | EBI-7950968 | 0.35 |
| Q99459 | Cell division cycle 5-like protein (Cdc5-like protein) (Pombe cdc5-related protein) | EBI-7954144 | 0.35 |
| Q5EWX9 | Nuclear pore protein pom121 (nuclear envelope pore membrane protein POM 121) | EBI-8070469 | 0.35 |
| Q16658 | Fascin (55 kDa actin-bundling protein) (Singed-like protein) (p55) | EBI-2893273 | 0.35 |
| O00629 | Importin subunit alpha-3 (Importin alpha Q1) (Qip1) (Karyopherin subunit alpha-4) | EBI-8291902 | 0.74 |
| Q8K4J6 | Myocardin-related transcription factor A (MRTF-A) (Basic SAP coiled-coil transcription activator) (MKL/myocardin-like protein 1) (Megakaryoblastic leukemia 1 protein homolog) (Megakaryocytic acute leukemia protein homolog) | EBI-8292094 | 0.52 |
| Q00610 | Clathrin heavy chain 1 (Clathrin heavy chain on chromosome 17) (CLH-17) | EBI-4373239 | 0.35 |
| Q15075 | Early endosome antigen 1 (Endosome-associated protein p162) (Zinc finger FYVE domain-containing protein 2) | EBI-4373273 | 0.35 |
| P42566 | Epidermal growth factor receptor substrate 15 (Protein Eps15) (Protein AF-1p) | EBI-4373380 | 0.40 |
| P50570 | Dynamin-2 (EC 3.6.5.5) | EBI-4373384 | 0.35 |
| Q14696 | LRP chaperone MESD (LDLR chaperone MESD) (Mesoderm development LRP chaperone MESD) (Mesoderm development candidate 2) (Mesoderm development protein) (Renal carcinoma antigen NY-REN-61) | EBI-7246101 | 0.37 |
| Q5TAQ9 | DDB1- and CUL4-associated factor 8 (WD repeat-containing protein 42A) | EBI-7817974 | 0.40 |
| P0C1C7 | Protein W | EBI-6157992 | 0.35 |
| P0C1C6 | Protein W | EBI-6158469 | 0.35 |
| Q05322 | Membrane-associated protein VP24 (Ebola VP24) (eVP24) | EBI-6159823 | 0.35 |
| P19320 | Vascular cell adhesion protein 1 (V-CAM 1) (VCAM-1) (INCAM-100) (CD antigen CD106) | EBI-6191068 | 0.53 |
| Q77M19 | V protein | EBI-6270503 | 0.35 |
| P02751 | Fibronectin (FN) (Cold-insoluble globulin) (CIG) [Cleaved into: Anastellin; Ugl-Y1; Ugl-Y2; Ugl-Y3] | EBI-6285956 | 0.35 |
| P49761 | Dual specificity protein kinase CLK3 (EC 2.7.12.1) (CDC-like kinase 3) | EBI-6380381 | 0.35 |
| Q9UBE8 | Serine/threonine-protein kinase NLK (EC 2.7.11.24) (Nemo-like kinase) (Protein LAK1) | EBI-6381385 | 0.35 |
| Q9UQ88 | Cyclin-dependent kinase 11A (EC 2.7.11.22) (Cell division cycle 2-like protein kinase 2) (Cell division protein kinase 11A) (Galactosyltransferase-associated protein kinase p58/GTA) (PITSLRE serine/threonine-protein kinase CDC2L2) | EBI-6381526 | 0.35 |
| Q86VP6 | Cullin-associated NEDD8-dissociated protein 1 (Cullin-associated and neddylation-dissociated protein 1) (TBP-interacting protein of 120 kDa A) (TBP-interacting protein 120A) (p120 CAND1) | EBI-21322532 | 0.35 |
| Q13618 | Cullin-3 (CUL-3) | EBI-21329068 | 0.35 |
| Q5S007 | Leucine-rich repeat serine/threonine-protein kinase 2 (EC 2.7.11.1) (EC 3.6.5.-) (Dardarin) | EBI-9515510 | 0.53 |
| Q13043 | Serine/threonine-protein kinase 4 (EC 2.7.11.1) (Mammalian STE20-like protein kinase 1) (MST-1) (STE20-like kinase MST1) (Serine/threonine-protein kinase Krs-2) [Cleaved into: Serine/threonine-protein kinase 4 37kDa subunit (MST1/N); Serine/threonine-protein kinase 4 18kDa subunit (MST1/C)] | EBI-10049645 | 0.35 |
| Q13418 | Integrin-linked protein kinase (EC 2.7.11.1) (59 kDa serine/threonine-protein kinase) (Beta-integrin-linked kinase) (ILK-1) (ILK-2) (p59ILK) | EBI-10103376 | 0.35 |
| O60674 | Tyrosine-protein kinase JAK2 (EC 2.7.10.2) (Janus kinase 2) (JAK-2) | EBI-10103554 | 0.35 |
| Q96FW1 | Ubiquitin thioesterase OTUB1 (EC 3.4.19.12) (Deubiquitinating enzyme OTUB1) (OTU domain-containing ubiquitin aldehyde-binding protein 1) (Otubain-1) (hOTU1) (Ubiquitin-specific-processing protease OTUB1) | EBI-10770198 | 0.35 |
| P05412 | Transcription factor Jun (Activator protein 1) (AP1) (Proto-oncogene c-Jun) (Transcription factor AP-1 subunit Jun) (V-jun avian sarcoma virus 17 oncogene homolog) (p39) | EBI-11323169 | 0.35 |
| P04620 | Protein Rev (ART/TRS) (Anti-repression transactivator) (Regulator of expression of viral proteins) | EBI-10687139 | 0.58 |
| P03225 | Protein BDLF2 | EBI-11722220 | 0.35 |
| P0C739 | Protein BNLF2a | EBI-11725101 | 0.35 |
| E9PUA5 | Kinesin-like protein | EBI-11016929 | 0.35 |
| Q8VE37 | Regulator of chromosome condensation (Chromosome condensation protein 1) | EBI-11043815 | 0.35 |
| P63280 | SUMO-conjugating enzyme UBC9 (EC 2.3.2.-) (RING-type E3 SUMO transferase UBC9) (SUMO-protein ligase) (Ubiquitin carrier protein 9) (mUBC9) (Ubiquitin carrier protein I) (Ubiquitin-conjugating enzyme E2 I) (Ubiquitin-protein ligase I) | EBI-11044140 | 0.35 |
| P34022 | Ran-specific GTPase-activating protein (HpaII tiny fragments locus 9a protein) (Ran-binding protein 1) (RANBP1) | EBI-11080066 | 0.35 |
| Q15398 | Disks large-associated protein 5 (DAP-5) (Discs large homolog 7) (Disks large-associated protein DLG7) (Hepatoma up-regulated protein) (HURP) | EBI-11083028 | 0.53 |
| Q6PFD6 | Kinesin-like protein KIF18B | EBI-11093571 | 0.35 |
| P18754 | Regulator of chromosome condensation (Cell cycle regulatory protein) (Chromosome condensation protein 1) | EBI-11115566 | 0.35 |
| Q9HCK8 | Chromodomain-helicase-DNA-binding protein 8 (CHD-8) (EC 3.6.4.12) (ATP-dependent helicase CHD8) (Helicase with SNF2 domain 1) | EBI-11115566 | 0.35 |
| Q96JN0 | Ligand-dependent corepressor (LCoR) (Mblk1-related protein 2) | EBI-11115566 | 0.35 |
| Q69YN4 | Protein virilizer homolog | EBI-11115566 | 0.35 |
| P52294 | Importin subunit alpha-5 (Karyopherin subunit alpha-1) (Nucleoprotein interactor 1) (NPI-1) (RAG cohort protein 2) (SRP1-beta) [Cleaved into: Importin subunit alpha-5, N-terminally processed] | EBI-11115566 | 0.69 |
| Q96JA3 | Pleckstrin homology domain-containing family A member 8 (PH domain-containing family A member 8) (Phosphatidylinositol-four-phosphate adapter protein 2) (FAPP-2) (Phosphoinositol 4-phosphate adapter protein 2) (hFAPP2) (Serologically defined breast cancer antigen NY-BR-86) | EBI-11115566 | 0.35 |
| Q15544 | Transcription initiation factor TFIID subunit 11 (TFIID subunit p30-beta) (Transcription initiation factor TFIID 28 kDa subunit) (TAF(II)28) (TAFII-28) (TAFII28) | EBI-11115566 | 0.35 |
| P62495 | Eukaryotic peptide chain release factor subunit 1 (Eukaryotic release factor 1) (eRF1) (Protein Cl1) (TB3-1) | EBI-11115566 | 0.35 |
| O60684 | Importin subunit alpha-7 (Karyopherin subunit alpha-6) | EBI-11115566 | 0.59 |
| Q96G23 | Ceramide synthase 2 (CerS2) (LAG1 longevity assurance homolog 2) (SP260) (Sphingosine N-acyltransferase CERS2) (EC 2.3.1.24) (Tumor metastasis-suppressor gene 1 protein) (Very-long-chain ceramide synthase CERS2) (EC 2.3.1.297) | EBI-11115566 | 0.35 |
| I3L0N3 | Vesicle-fusing ATPase (EC 3.6.4.6) | EBI-11115566 | 0.35 |
| Q8TEP8 | Centrosomal protein of 192 kDa (Cep192) (Cep192/SPD-2) | EBI-11115566 | 0.35 |
| O14715 | RANBP2-like and GRIP domain-containing protein 8 (Ran-binding protein 2-like 3) (RanBP2-like 3) (RanBP2L3) | EBI-11115566 | 0.35 |
| O15541 | E3 ubiquitin-protein ligase RNF113A (EC 2.3.2.27) (Cwc24 homolog) (RING finger protein 113A) (Zinc finger protein 183) | EBI-11115566 | 0.35 |
| Q96P63 | Serpin B12 | EBI-11115566 | 0.35 |
| Q8NI27 | THO complex subunit 2 (Tho2) (hTREX120) | EBI-11115566 | 0.35 |
| Q92750 | Transcription initiation factor TFIID subunit 4B (Transcription initiation factor TFIID 105 kDa subunit) (TAF(II)105) (TAFII-105) (TAFII105) | EBI-11115566 | 0.35 |
| P51648 | Aldehyde dehydrogenase family 3 member A2 (EC 1.2.1.3) (EC 1.2.1.94) (Aldehyde dehydrogenase 10) (Fatty aldehyde dehydrogenase) (Microsomal aldehyde dehydrogenase) | EBI-11115566 | 0.35 |
| J3QR07 | YTH domain-containing protein 1 | EBI-11115566 | 0.35 |
| Q6NUQ4 | Transmembrane protein 214 | EBI-11115566 | 0.35 |
| Q9BXS6 | Nucleolar and spindle-associated protein 1 (NuSAP) | EBI-11115566 | 0.35 |
| Q69YH5 | Cell division cycle-associated protein 2 (Recruits PP1 onto mitotic chromatin at anaphase protein) (Repo-Man) | EBI-11115566 | 0.35 |
| Q9UDW1 | Cytochrome b-c1 complex subunit 9 (Complex III subunit 9) (Complex III subunit X) (Cytochrome c1 non-heme 7 kDa protein) (Ubiquinol-cytochrome c reductase complex 7.2 kDa protein) | EBI-11115566 | 0.35 |
| Q86VU5 | Catechol O-methyltransferase domain-containing protein 1 (EC 2.1.1.-) | EBI-11115566 | 0.35 |
| Q9BW19 | Kinesin-like protein KIFC1 (Kinesin-like protein 2) (Kinesin-related protein HSET) | EBI-11115566 | 0.35 |
| E9PF10 | Nuclear pore complex protein Nup155 | EBI-11115566 | 0.35 |
| O75448 | Mediator of RNA polymerase II transcription subunit 24 (Activator-recruited cofactor 100 kDa component) (ARC100) (Cofactor required for Sp1 transcriptional activation subunit 4) (CRSP complex subunit 4) (Mediator complex subunit 24) (Thyroid hormone receptor-associated protein 4) (Thyroid hormone receptor-associated protein complex 100 kDa component) (Trap100) (hTRAP100) (Vitamin D3 receptor-interacting protein complex 100 kDa component) (DRIP100) | EBI-11115566 | 0.35 |
| Q96SK2 | Transmembrane protein 209 | EBI-11115566 | 0.35 |
| Q9P0U3 | Sentrin-specific protease 1 (EC 3.4.22.-) (Sentrin/SUMO-specific protease SENP1) | EBI-11115566 | 0.35 |
| P43487 | Ran-specific GTPase-activating protein (Ran-binding protein 1) (RanBP1) | EBI-11115566 | 0.35 |
| Q53EZ4 | Centrosomal protein of 55 kDa (Cep55) (Up-regulated in colon cancer 6) | EBI-11115566 | 0.35 |
| Q8N2Y8 | AP-4 complex accessory subunit RUSC2 (Interacting protein of Rab1) (Iporin) (RUN and SH3 domain-containing protein 2) | EBI-11115566 | 0.35 |
| P55084 | Trifunctional enzyme subunit beta, mitochondrial (TP-beta) [Includes: 3-ketoacyl-CoA thiolase (EC 2.3.1.155) (EC 2.3.1.16) (Acetyl-CoA acyltransferase) (Beta-ketothiolase)] | EBI-11115566 | 0.35 |
| O95373 | Importin-7 (Imp7) (Ran-binding protein 7) (RanBP7) | EBI-11115566 | 0.59 |
| O00505 | Importin subunit alpha-4 (Importin alpha Q2) (Qip2) (Karyopherin subunit alpha-3) (SRP1-gamma) | EBI-11115566 | 0.71 |
| Q6PJT7 | Zinc finger CCCH domain-containing protein 14 (Mammalian suppressor of tau pathology-2) (MSUT-2) (Renal carcinoma antigen NY-REN-37) | EBI-11115566 | 0.35 |
| O14975 | Long-chain fatty acid transport protein 2 (Arachidonate--CoA ligase) (EC 6.2.1.15) (Fatty acid transport protein 2) (FATP-2) (Fatty-acid-coenzyme A ligase, very long-chain 1) (Long-chain-fatty-acid--CoA ligase) (EC 6.2.1.3) (Phytanate--CoA ligase) (EC 6.2.1.24) (Solute carrier family 27 member 2) (THCA-CoA ligase) (EC 6.2.1.7) (Very long-chain acyl-CoA synthetase) (VLACS) (VLCS) (EC 6.2.1.-) (Very long-chain-fatty-acid-CoA ligase) | EBI-11115566 | 0.35 |
| Q9HB58 | Sp110 nuclear body protein (Interferon-induced protein 41/75) (Speckled 110 kDa) (Transcriptional coactivator Sp110) | EBI-11115566 | 0.35 |
| O75909 | Cyclin-K | EBI-11115566 | 0.35 |
| Q86VQ0 | Lebercilin (Leber congenital amaurosis 5 protein) | EBI-11363336 | 0.35 |
| P48039 | Melatonin receptor type 1A (Mel-1A-R) (Mel1a receptor) | EBI-11577056 | 0.00 |
| O96017 | Serine/threonine-protein kinase Chk2 (EC 2.7.11.1) (CHK2 checkpoint homolog) (Cds1 homolog) (Hucds1) (hCds1) (Checkpoint kinase 2) | EBI-11579031 | 0.35 |
| P27105 | Stomatin (Erythrocyte band 7 integral membrane protein) (Erythrocyte membrane protein band 7.2) (Protein 7.2b) | EBI-12452286 | 0.51 |
| Q71U36 | Tubulin alpha-1A chain (EC 3.6.5.-) (Alpha-tubulin 3) (Tubulin B-alpha-1) (Tubulin alpha-3 chain) [Cleaved into: Detyrosinated tubulin alpha-1A chain] | EBI-11897791 | 0.35 |
| P03427 | Polymerase basic protein 2 (RNA-directed RNA polymerase subunit P3) | EBI-14404759 | 0.35 |
| P46531 | Neurogenic locus notch homolog protein 1 (Notch 1) (hN1) (Translocation-associated notch protein TAN-1) [Cleaved into: Notch 1 extracellular truncation (NEXT); Notch 1 intracellular domain (NICD)] | EBI-13915571 | 0.35 |
| A9QM74 | Importin subunit alpha-8 (Karyopherin subunit alpha-7) | EBI-13950021 | 0.44 |
| O15355 | Protein phosphatase 1G (EC 3.1.3.16) (Protein phosphatase 1C) (Protein phosphatase 2C isoform gamma) (PP2C-gamma) (Protein phosphatase magnesium-dependent 1 gamma) | EBI-14023765 | 0.35 |
| O15297 | Protein phosphatase 1D (EC 3.1.3.16) (Protein phosphatase 2C isoform delta) (PP2C-delta) (Protein phosphatase magnesium-dependent 1 delta) (p53-induced protein phosphatase 1) | EBI-14024588 | 0.53 |
| P36873 | Serine/threonine-protein phosphatase PP1-gamma catalytic subunit (PP-1G) (EC 3.1.3.16) (Protein phosphatase 1C catalytic subunit) | EBI-14025388 | 0.42 |
| P56180 | Putative tyrosine-protein phosphatase TPTE (EC 3.1.3.48) (Cancer/testis antigen 44) (CT44) (Transmembrane phosphatase with tensin homology) (Tumor antigen BJ-HCC-5) | EBI-14025693 | 0.42 |
| P62140 | Serine/threonine-protein phosphatase PP1-beta catalytic subunit (PP-1B) (PPP1CD) (EC 3.1.3.16) (EC 3.1.3.53) | EBI-14026087 | 0.42 |
| Q6IQ23 | Pleckstrin homology domain-containing family A member 7 (PH domain-containing family A member 7) | EBI-16398399 | 0.59 |
| P10275 | Androgen receptor (Dihydrotestosterone receptor) (Nuclear receptor subfamily 3 group C member 4) | EBI-15187911 | 0.40 |
| O43524 | Forkhead box protein O3 (AF6q21 protein) (Forkhead in rhabdomyosarcoma-like 1) | EBI-15187932 | 0.35 |
| Q9NPC8 | Homeobox protein SIX2 (Sine oculis homeobox homolog 2) | EBI-21617697 | 0.35 |
| P61769 | Beta-2-microglobulin [Cleaved into: Beta-2-microglobulin form pI 5.3] | EBI-21675069 | 0.35 |
| Q5SSJ5 | Heterochromatin protein 1-binding protein 3 (Protein HP1-BP74) | EBI-21734720 | 0.35 |
| Q2NL82 | Pre-rRNA-processing protein TSR1 homolog | EBI-21815364 | 0.35 |
| P54645 | 5'-AMP-activated protein kinase catalytic subunit alpha-1 (AMPK subunit alpha-1) (EC 2.7.11.1) (Acetyl-CoA carboxylase kinase) (ACACA kinase) (EC 2.7.11.27) (Hydroxymethylglutaryl-CoA reductase kinase) (HMGCR kinase) (EC 2.7.11.31) (Tau-protein kinase PRKAA1) (EC 2.7.11.26) | EBI-16361875 | 0.35 |
| P80386 | 5'-AMP-activated protein kinase subunit beta-1 (AMPK subunit beta-1) (AMPKb) (5'-AMP-activated protein kinase 40 kDa subunit) | EBI-16362252 | 0.35 |
| O95149 | Snurportin-1 (RNA U transporter 1) | EBI-15577065 | 0.44 |
| P52298 | Nuclear cap-binding protein subunit 2 (20 kDa nuclear cap-binding protein) (Cell proliferation-inducing gene 55 protein) (NCBP 20 kDa subunit) (CBP20) (NCBP-interacting protein 1) (NIP1) | EBI-15798493 | 0.52 |
| Q09161 | Nuclear cap-binding protein subunit 1 (80 kDa nuclear cap-binding protein) (CBP80) (NCBP 80 kDa subunit) | EBI-15798552 | 0.40 |
| Q9BUR4 | Telomerase Cajal body protein 1 (WD repeat-containing protein 79) (WD40 repeat-containing protein antisense to TP53 gene) (WRAP53beta) | EBI-15892338 | 0.35 |
| P03950 | Angiogenin (EC 3.1.27.-) (Ribonuclease 5) (RNase 5) | EBI-16363282 | 0.35 |
| Q14684 | Ribosomal RNA processing protein 1 homolog B (RRP1-like protein B) | EBI-16686997 | 0.35 |
| P62753 | 40S ribosomal protein S6 (Phosphoprotein NP33) (Small ribosomal subunit protein eS6) | EBI-16799122 | 0.35 |
| O94776 | Metastasis-associated protein MTA2 (Metastasis-associated 1-like 1) (MTA1-L1 protein) (p53 target protein in deacetylase complex) | EBI-16803315 | 0.35 |
| P09622 | Dihydrolipoyl dehydrogenase, mitochondrial (EC 1.8.1.4) (Dihydrolipoamide dehydrogenase) (Glycine cleavage system L protein) | EBI-20304669 | 0.35 |
| P36957 | Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial (EC 2.3.1.61) (2-oxoglutarate dehydrogenase complex component E2) (OGDC-E2) (Dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex) (E2K) | EBI-20305285 | 0.35 |
| O00429 | Dynamin-1-like protein (EC 3.6.5.5) (Dnm1p/Vps1p-like protein) (DVLP) (Dynamin family member proline-rich carboxyl-terminal domain less) (Dymple) (Dynamin-like protein) (Dynamin-like protein 4) (Dynamin-like protein IV) (HdynIV) (Dynamin-related protein 1) | EBI-20305770 | 0.35 |
| Q99714 | 3-hydroxyacyl-CoA dehydrogenase type-2 (EC 1.1.1.35) (17-beta-estradiol 17-dehydrogenase) (EC 1.1.1.62) (2-methyl-3-hydroxybutyryl-CoA dehydrogenase) (MHBD) (3-alpha-(17-beta)-hydroxysteroid dehydrogenase (NAD(+))) (EC 1.1.1.239) (3-hydroxy-2-methylbutyryl-CoA dehydrogenase) (EC 1.1.1.178) (3-hydroxyacyl-CoA dehydrogenase type II) (3alpha(or 20beta)-hydroxysteroid dehydrogenase) (EC 1.1.1.53) (7-alpha-hydroxysteroid dehydrogenase) (EC 1.1.1.159) (Endoplasmic reticulum-associated amyloid beta-peptide-binding protein) (Mitochondrial ribonuclease P protein 2) (Mitochondrial RNase P protein 2) (Short chain dehydrogenase/reductase family 5C member 1) (Short-chain type dehydrogenase/reductase XH98G2) (Type II HADH) | EBI-20306067 | 0.35 |
| P08559 | Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial (EC 1.2.4.1) (PDHE1-A type I) | EBI-20306509 | 0.35 |
| P31040 | Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial (EC 1.3.5.1) (Flavoprotein subunit of complex II) (Fp) | EBI-20306992 | 0.35 |
| P35610 | Sterol O-acyltransferase 1 (EC 2.3.1.26) (Acyl-coenzyme A:cholesterol acyltransferase 1) (ACAT-1) (Cholesterol acyltransferase 1) | EBI-20307233 | 0.35 |
| P00441 | Superoxide dismutase [Cu-Zn] (EC 1.15.1.1) (Superoxide dismutase 1) (hSod1) | EBI-20307497 | 0.35 |
| P21796 | Voltage-dependent anion-selective channel protein 1 (VDAC-1) (hVDAC1) (Outer mitochondrial membrane protein porin 1) (Plasmalemmal porin) (Porin 31HL) (Porin 31HM) | EBI-20307902 | 0.35 |
| P51957 | Serine/threonine-protein kinase Nek4 (EC 2.7.11.1) (Never in mitosis A-related kinase 4) (NimA-related protein kinase 4) (Serine/threonine-protein kinase 2) (Serine/threonine-protein kinase NRK2) | EBI-20722397 | 0.35 |
| P10636 | Microtubule-associated protein tau (Neurofibrillary tangle protein) (Paired helical filament-tau) (PHF-tau) | EBI-20799058 | 0.35 |
| A2A935 | Histone-lysine N-methyltransferase PRDM16 (EC 2.1.1.367) (PR domain zinc finger protein 16) (PR domain-containing protein 16) (Transcription factor MEL1) (MDS1/EVI1-like gene 1) | EBI-21024514 | 0.35 |
| P14404 | Histone-lysine N-methyltransferase MECOM (EC 2.1.1.367) (Ecotropic virus integration site 1 protein) (EVI-1) (MDS1 and EVI1 complex locus protein) (Myelodysplasia syndrome 1 protein homolog) | EBI-21026252 | 0.35 |
| P56817 | Beta-secretase 1 (EC 3.4.23.46) (Aspartyl protease 2) (ASP2) (Asp 2) (Beta-site amyloid precursor protein cleaving enzyme 1) (Beta-site APP cleaving enzyme 1) (Memapsin-2) (Membrane-associated aspartic protease 2) | EBI-20992725 | 0.35 |
| P04156 | Major prion protein (PrP) (ASCR) (PrP27-30) (PrP33-35C) (CD antigen CD230) | EBI-21014477 | 0.35 |
| P04233 | HLA class II histocompatibility antigen gamma chain (HLA-DR antigens-associated invariant chain) (Ia antigen-associated invariant chain) (Ii) (CD antigen CD74) [Cleaved into: Class-II-associated invariant chain peptide (CLIP)] | EBI-21258980 | 0.50 |
| Q99558 | Mitogen-activated protein kinase kinase kinase 14 (EC 2.7.11.25) (NF-kappa-beta-inducing kinase) (HsNIK) (Serine/threonine-protein kinase NIK) | EBI-21261374 | 0.50 |
| Q15077 | P2Y purinoceptor 6 (P2Y6) | EBI-21262943 | 0.50 |
| F5H1C8 | Solute carrier family 15 member 3 (Solute carrier family 15, member 3, isoform CRA_a) | EBI-21264930 | 0.50 |
| Q9Y275 | Tumor necrosis factor ligand superfamily member 13B (B lymphocyte stimulator) (BLyS) (B-cell-activating factor) (BAFF) (Dendritic cell-derived TNF-like molecule) (TNF- and APOL-related leukocyte expressed ligand 1) (TALL-1) (CD antigen CD257) [Cleaved into: Tumor necrosis factor ligand superfamily member 13b, membrane form; Tumor necrosis factor ligand superfamily member 13b, soluble form] | EBI-21266480 | 0.50 |
| Q9H1C4 | Protein unc-93 homolog B1 (Unc-93B1) (hUNC93B1) | EBI-21266770 | 0.50 |
| P42858 | Huntingtin (Huntington disease protein) (HD protein) [Cleaved into: Huntingtin, myristoylated N-terminal fragment] | EBI-21132926 | 0.35 |
| P12004 | Proliferating cell nuclear antigen (PCNA) (Cyclin) | EBI-21236861 | 0.37 |
| Q9NRI5 | Disrupted in schizophrenia 1 protein | EBI-30827879 | 0.59 |
| P09613 | Envelopment polyprotein (M polyprotein) (p110) [Cleaved into: Glycoprotein N (Gn) (Glycoprotein G1); Glycoprotein C (Gc) (Glycoprotein G2)] | EBI-21497303 | 0.35 |
| Q16526 | Cryptochrome-1 | EBI-21981854 | 0.35 |
| Q13164 | Mitogen-activated protein kinase 7 (MAP kinase 7) (MAPK 7) (EC 2.7.11.24) (Big MAP kinase 1) (BMK-1) (Extracellular signal-regulated kinase 5) (ERK-5) | EBI-25374538 | 0.35 |
| P11234 | Ras-related protein Ral-B (EC 3.6.5.2) | EBI-25376255 | 0.35 |
| Q92934 | Bcl2-associated agonist of cell death (BAD) (Bcl-2-binding component 6) (Bcl-2-like protein 8) (Bcl2-L-8) (Bcl-xL/Bcl-2-associated death promoter) (Bcl2 antagonist of cell death) | EBI-25378368 | 0.35 |
| P0DOF2 | Matrix protein (Phosphoprotein M2) | EBI-25603126 | 0.35 |
| Q9BY14 | Testis-expressed protein 101 (Cell surface receptor NYD-SP8) (Scleroderma-associated autoantigen) (Spermatogenesis-related gene protein) | EBI-25505396 | 0.35 |
| A0A3G5BIZ0 | ORF6 protein (Accessory protein 6) (Non-structural protein 6) | EBI-25565269 | 0.43 |
| Q9C0B5 | Palmitoyltransferase ZDHHC5 (EC 2.3.1.225) (Zinc finger DHHC domain-containing protein 5) (DHHC-5) (Zinc finger protein 375) | EBI-25636144 | 0.35 |
| B3CRR2 | Ankyrin repeat-containing protein 01_02 | EBI-26357604 | 0.50 |
| B3CTB0 | Ankyrin repeat-containing protein 06_02 (Ankyrin repeat-containing protein 06_03) (Ankyrin repeat-containing protein 06_04) | EBI-26357616 | 0.35 |
| Q53F19 | Nuclear cap-binding protein subunit 3 (Protein ELG) | EBI-26396827 | 0.35 |
| P35226 | Polycomb complex protein BMI-1 (Polycomb group RING finger protein 4) (RING finger protein 51) | EBI-27109494 | 0.35 |
| Q8N488 | RING1 and YY1-binding protein (Apoptin-associating protein 1) (APAP-1) (Death effector domain-associated factor) (DED-associated factor) (YY1 and E4TF1-associated factor 1) | EBI-27111302 | 0.35 |
| Q99592 | Zinc finger and BTB domain-containing protein 18 (58 kDa repressor protein) (Transcriptional repressor RP58) (Translin-associated zinc finger protein 1) (TAZ-1) (Zinc finger protein 238) (Zinc finger protein C2H2-171) | EBI-27093179 | 0.35 |
| Q8NCK7 | Monocarboxylate transporter 11 (MCT 11) (Solute carrier family 16 member 11) | EBI-27103180 | 0.35 |
| Q05D32 | CTD small phosphatase-like protein 2 (CTDSP-like 2) (EC 3.1.3.-) | EBI-27113232 | 0.35 |
| P0DTC4 | Envelope small membrane protein (E) (sM protein) | EBI-28955127 | 0.35 |
| Q5HYC2 | Uncharacterized protein KIAA2026 | EBI-30827309 | 0.44 |
| O96028 | Histone-lysine N-methyltransferase NSD2 (EC 2.1.1.357) (Multiple myeloma SET domain-containing protein) (MMSET) (Nuclear SET domain-containing protein 2) (Protein trithorax-5) (Wolf-Hirschhorn syndrome candidate 1 protein) | EBI-30827207 | 0.44 |
| Q6ZQQ2 | Spermatogenesis-associated protein 31D1 (Protein FAM75D1) | EBI-30827357 | 0.44 |
| Q6ZUB0 | Spermatogenesis-associated protein 31D4 (Protein FAM75D4) | EBI-30827368 | 0.44 |
| Q702N8 | Xin actin-binding repeat-containing protein 1 (Cardiomyopathy-associated protein 1) | EBI-30827379 | 0.44 |
| Q7RTY1 | Monocarboxylate transporter 9 (MCT 9) (Solute carrier family 16 member 9) | EBI-30827390 | 0.44 |
| Q7Z6M1 | Rab9 effector protein with kelch motifs (40 kDa Rab9 effector protein) (p40) | EBI-30827401 | 0.44 |
| Q8N398 | von Willebrand factor A domain-containing protein 5B2 | EBI-30827412 | 0.44 |
| O15397 | Importin-8 (Imp8) (Ran-binding protein 8) (RanBP8) | EBI-30827163 | 0.44 |
| O43307 | Rho guanine nucleotide exchange factor 9 (Collybistin) (PEM-2 homolog) (Rac/Cdc42 guanine nucleotide exchange factor 9) | EBI-30827174 | 0.44 |
| O43520 | Phospholipid-transporting ATPase IC (EC 7.6.2.1) (ATPase class I type 8B member 1) (Familial intrahepatic cholestasis type 1) (P4-ATPase flippase complex alpha subunit ATP8B1) | EBI-30827185 | 0.44 |
| O15321 | Transmembrane 9 superfamily member 1 (MP70 protein family member) (hMP70) | EBI-30827152 | 0.44 |
| O00750 | Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta (PI3K-C2-beta) (PtdIns-3-kinase C2 subunit beta) (EC 2.7.1.137) (EC 2.7.1.154) (C2-PI3K) (Phosphoinositide 3-kinase-C2-beta) | EBI-30827141 | 0.44 |
| P0C874 | Spermatogenesis-associated protein 31D3 (Protein FAM75D3) | EBI-30827232 | 0.44 |
| Q5XG87 | Terminal nucleotidyltransferase 4A (DNA polymerase sigma) (LAK-1) (Non-canonical poly(A) RNA polymerase PAPD7) (EC 2.7.7.19) (PAP-associated domain-containing protein 7) (TRAMP-like complex polyadenylate polymerase) (Terminal guanylyltransferase) (EC 2.7.7.-) (Terminal uridylyltransferase 5) (TUTase 5) (Topoisomerase-related function protein 4-1) (TRF4-1) | EBI-30827320 | 0.44 |
| Q9H207 | Olfactory receptor 10A5 (HP3) (Olfactory receptor 10A1) (Olfactory receptor 11-403) (OR11-403) (Olfactory receptor-like protein JCG6) | EBI-30827679 | 0.44 |
| Q9C0D9 | Ethanolaminephosphotransferase 1 (hEPT1) (EC 2.7.8.1) (Selenoprotein I) (SelI) | EBI-30827646 | 0.44 |
| Q9BZ95 | Histone-lysine N-methyltransferase NSD3 (EC 2.1.1.370) (EC 2.1.1.371) (Nuclear SET domain-containing protein 3) (Protein whistle) (WHSC1-like 1 isoform 9 with methyltransferase activity to lysine) (Wolf-Hirschhorn syndrome candidate 1-like protein 1) (WHSC1-like protein 1) | EBI-30827635 | 0.44 |
| Q96R08 | Olfactory receptor 5B12 (Olfactory receptor 5B16) (Olfactory receptor OR11-241) | EBI-30827624 | 0.44 |
| Q92615 | La-related protein 4B (La ribonucleoprotein domain family member 4B) (La ribonucleoprotein domain family member 5) (La-related protein 5) | EBI-30827577 | 0.44 |
| Q8NGY0 | Olfactory receptor 10X1 (Olfactory receptor OR1-14) | EBI-30827566 | 0.44 |
| Q8NGI9 | Olfactory receptor 5A2 (Olfactory receptor OR11-248) | EBI-30827537 | 0.44 |
| Q8NGA6 | Olfactory receptor 10H5 (Olfactory receptor OR19-25) (Olfactory receptor OR19-26) | EBI-30827526 | 0.44 |
| Q8N7C0 | Leucine-rich repeat-containing protein 52 (BK channel auxiliary gamma subunit LRRC52) | EBI-30827423 | 0.44 |
| Q8NCP5 | Zinc finger and BTB domain-containing protein 44 (BTB/POZ domain-containing protein 15) (Zinc finger protein 851) | EBI-30827434 | 0.44 |
| Q9H208 | Olfactory receptor 10A2 (HP4) (Olfactory receptor OR11-86) | EBI-30827709 | 0.44 |
| Q8NGA2 | Putative olfactory receptor 7A2 (Putative olfactory receptor 7A7) | EBI-30827490 | 0.44 |
| Q8NG92 | Olfactory receptor 13H1 (Olfactory receptor ORX-1) | EBI-30827464 | 0.44 |
| Q9H6Z4 | Ran-binding protein 3 (RanBP3) | EBI-30827857 | 0.44 |
| Q9NRD1 | F-box only protein 6 (F-box protein that recognizes sugar chains 2) (F-box/G-domain protein 2) | EBI-30827868 | 0.44 |
| Q9Y399 | 28S ribosomal protein S2, mitochondrial (MRP-S2) (S2mt) (Mitochondrial small ribosomal subunit protein uS2m) | EBI-30827920 | 0.44 |
| Q9NZP0 | Olfactory receptor 6C3 (HSA8) | EBI-30827909 | 0.44 |
Database | Links |
| UNIPROT | Q14974 B7ZAV6 D3DTT3 Q14637 Q53XN2 Q96J27 |
| PDB | 1F59 1IBR 1M5N 1O6O 1O6P 1QGK 1QGR 2P8Q 2Q5D 2QNA 3LWW 3W5K 6N88 6N89 |
| Pfam | PF03810 |
| PROSITE | PS50077 PS50166 |
| OMIM | 602738 |
| DisGeNET | 3837 |
National and Kapodistrian University of Athens
Department of Biology
Biophysics & Bioinformatics Laboratory