NucEnvDB

NucEnvDB

A database of Nuclear Envelope Proteins and their Interactions

Pleckstrin homology domain-containing family F member 1 - Homo sapiens - NucEnvDB

Pleckstrin homology domain-containing family F member 1 (Homo sapiens)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	Pleckstrin homology domain-containing family F member 1
Accession Code	Q96S99
Gene	PLEKHF1
Organism	Homo sapiens \| Human (Taxonomy: 9606)
Part of Reference Proteome?	Yes
Sequence (Length: 279)
MVDHLANTEINSQRIAAVESCFGASGQPLALPGRVLLGEGVLTKECRKKAKPRIFFLFNDILVYGSIVLNKRKYRSQHIIPLEEVTLELLPETLQAKNRWMIKTAKKSFVVSAASATERQEWISHIEECV RRQLRATGRPPSTEHAAPWIPDKATDICMRCTQTRFSALTRRHHCRKCGFVVCAECSRQRFLLPRLSPKPVRVCSLCYRELAAQQRQEEAEEQGAGSPGQPAHLARPICGASSGDDDDSDEDKEGSRDGD WPSSVEFYASGVAWSAFHS

Subcellular Location

Description
Nucleus {Experimental EvidencePubMed:16188880}. Cytoplasm, perinuclear region {Experimental EvidencePubMed:16188880}. Lysosome {Experimental EvidencePubMed:16188880}. Note=Translocates to lysosome during apoptosis.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Unknown	UniProt	Sequence Analysis
Assigned Ontology terms

Cellular Component	Early Endosome (GO:0005769) Endosome Membrane (GO:0010008) Lysosomal Membrane (GO:0005765) Lysosome (GO:0005764) Nucleus (GO:0005634) Perinuclear Region Of Cytoplasm (GO:0048471)

Biology & Function

Description
May induce apoptosis through the lysosomal-mitochondrial pathway. Translocates to the lysosome initiating the permeabilization of lysosomal membrane (LMP) and resulting in the release of CTSD and CTSL to the cytoplasm. Triggers the caspase-independent apoptosis by altering mitochondrial membrane permeabilization (MMP) resulting in the release of PDCD8. {Experimental EvidencePubMed:16188880}.
Assigned Ontology terms

Biological Process	Apoptotic Process (GO:0006915) Endosome Organization (GO:0007032) Endosome To Lysosome Transport (GO:0008333) Positive Regulation Of Autophagy (GO:0010508) Positive Regulation Of Intrinsic Apoptotic Signaling Pathway (GO:2001244) Protein Localization To Plasma Membrane (GO:0072659) Vesicle Organization (GO:0016050)
Molecular Function	Metal Ion Binding (GO:0046872) Phosphatidylinositol Binding (GO:0035091) Phosphatidylinositol-3-Phosphate Binding (GO:0032266) Phosphatidylinositol-4-Phosphate Binding (GO:0070273) Phosphatidylinositol-5-Phosphate Binding (GO:0010314)

Protein-Protein Interactions

Interactions with other proteins (7 interactors)

Partner (UniProt)		IntAct	Confidence score
P13805	Troponin T, slow skeletal muscle (TnTs) (Slow skeletal muscle troponin T) (sTnT)	EBI-754699	0.37
Q96EK5	KIF-binding protein (KIF1-binding protein) (Kinesin family binding protein)	EBI-757246	0.37
Q96JM7	Lethal(3)malignant brain tumor-like protein 3 (H-l(3)mbt-like protein 3) (L(3)mbt-like protein 3) (L3mbt-like 3) (MBT-1)	EBI-10293337	0.56
O95810	Caveolae-associated protein 2 (Cavin-2) (PS-p68) (Phosphatidylserine-binding protein) (Serum deprivation-response protein)	EBI-24333775	0.56
Q9UKJ5	Cysteine-rich hydrophobic domain-containing protein 2 (BrX-like translocated in leukemia)	EBI-24626977	0.56
Q86SE8	Nucleoplasmin-2	EBI-24411098	0.56
O95379	Tumor necrosis factor alpha-induced protein 8 (TNF alpha-induced protein 8) (Head and neck tumor and metastasis-related protein) (MDC-3.13) (NF-kappa-B-inducible DED-containing protein) (NDED) (SCC-S2) (TNF-induced protein GG2-1)	EBI-24584209	0.56

Cross-References

Database	Links
UNIPROT	Q96S99 Q96K11 Q9BUB9
Pfam	PF01363 PF00169
PROSITE	PS50003 PS50178
OMIM	615200
DisGeNET	79156

Powered by W3.css | Privacy Notice

x

This website uses cookies to improve user experience. By using NucEnvDB you consent to all cookies in accordance with our privacy policy. OK