Protein Information |
|
---|---|
Protein Name | Sortilin |
Accession Code | Q99523 |
Gene | SORT1 |
Organism | Homo sapiens | Human (Taxonomy: 9606) |
Part of Reference Proteome? | Yes |
Sequence (Length: 831) | |
MERPWGAADGLSRWPHGLGLLLLLQLLPPSTLSQDRLDAPPPPAAPLPRWSGPIGVSWGLRAAAAGGAFPRGGRWRRSAP GEDEECGRVRDFVAKLANNTHQHVFDDLRGSVSLSWVGDSTGVILVLTTFHVPLVIMTFGQSKLYRSEDYGKNFKDITDL INNTFIRTEFGMAIGPENSGKVVLTAEVSGGSRGGRIFRSSDFAKNFVQTDLPFHPLTQMMYSPQNSDYLLALSTENGLW VSKNFGGKWEEIHKAVCLAKWGSDNTIFFTTYANGSCKADLGALELWRTSDLGKSFKTIGVKIYSFGLGGRFLFASVMAD KDTTRRIHVSTDQGDTWSMAQLPSVGQEQFYSILAANDDMVFMHVDEPGDTGFGTIFTSDDRGIVYSKSLDRHLYTTTGG ETDFTNVTSLRGVYITSVLSEDNSIQTMITFDQGGRWTHLRKPENSECDATAKNKNECSLHIHASYSISQKLNVPMAPLS EPNAVGIVIAHGSVGDAISVMVPDVYISDDGGYSWTKMLEGPHYYTILDSGGIIVAIEHSSRPINVIKFSTDEGQCWQTY TFTRDPIYFTGLASEPGARSMNISIWGFTESFLTSQWVSYTIDFKDILERNCEEKDYTIWLAHSTDPEDYEDGCILGYKE QFLRLRKSSVCQNGRDYVVTKQPSICLCSLEDFLCDFGYYRPENDSKCVEQPELKGHDLEFCLYGREEHLTTNGYRKIPG DKCQGGVNPVREVKDLKKKCTSNFLSPEKQNSKSNSVPIILAIVGLMLVTVVAGVLIVKKYVCGGRFLVHRYSVLQQHAE ANGVDGVDALDTASHTNKSGYHDDSDEDLLE |
Structure Viewer (PDB: 4PO7) |
---|
Description |
||
---|---|---|
Golgi apparatus, Golgi stack membrane {Experimental EvidencePubMed:16787399, Experimental EvidencePubMed:18817523}; Single-pass type I membrane protein {Curator Inference}. Endosome membrane {Experimental EvidencePubMed:18817523}; Single-pass type I membrane protein {Curator Inference}. Endoplasmic reticulum membrane {Curator Inference}; Single- pass type I membrane protein {Curator Inference}. Nucleus membrane {Curator Inference}; Single-pass type I membrane protein {Curator Inference}. Cell membrane; Single-pass type I membrane protein; Extracellular side. Lysosome membrane {Curator Inference}; Single-pass type I membrane protein {Curator Inference}. Note=Localized to membranes of the endoplasmic reticulum, endosomes, Golgi stack, lysosomes and nucleus. A small fraction of the protein is also localized to the plasma membrane. May also be found in SLC2A4/GLUT4 storage vesicles (GSVs) in adipocytes. Localization to the plasma membrane in adipocytes may be enhanced by insulin. | Position in the Nuclear Envelope |
|
Location | Location ID | Description |
Nuclear Envelope | SL-0178 | The nuclear envelope is a membrane system which surrounds the nucleoplasm of eukaryotic cells. It is composed of the nuclear lamina, nuclear pore complexes and two nuclear membranes. The space between the two membranes is called the nuclear intermembrane space. |
Nuclear Membrane | SL-0182 | The membrane surrounding the nucleus. This term is used when it is not known if the protein is found in or associated with the inner or outer nuclear membrane. | Membrane Topology |
Topology | Source | Annotation Type |
Transmembrane | UniProt | Sequence Analysis {ECO:0000255} | Assigned Ontology terms |
Cellular Component | Cell Surface (GO:0009986) Clathrin-Coated Pit (GO:0005905) Clathrin-Coated Vesicle (GO:0030136) Cytoplasmic Vesicle (GO:0031410) Cytosol (GO:0005829) Early Endosome (GO:0005769) Endoplasmic Reticulum Membrane (GO:0005789) Endosome Membrane (GO:0010008) Golgi Apparatus (GO:0005794) Golgi Cisterna Membrane (GO:0032580) Lysosomal Membrane (GO:0005765) Lysosome (GO:0005764) Nuclear Membrane (GO:0031965) Perinuclear Region Of Cytoplasm (GO:0048471) Plasma Membrane (GO:0005886) Trans-Golgi Network Transport Vesicle (GO:0030140) |
Description |
|
---|---|
Functions as a sorting receptor in the Golgi compartment and as a clearance receptor on the cell surface. Required for protein transport from the Golgi apparatus to the lysosomes by a pathway that is independent of the mannose-6-phosphate receptor (M6PR). Lysosomal proteins bind specifically to the receptor in the Golgi apparatus and the resulting receptor-ligand complex is transported to an acidic prelysosomal compartment where the low pH mediates the dissociation of the complex (PubMed:16787399). The receptor is then recycled back to the Golgi for another round of trafficking through its binding to the retromer. Also required for protein transport from the Golgi apparatus to the endosomes. Promotes neuronal apoptosis by mediating endocytosis of the proapoptotic precursor forms of BDNF (proBDNF) and NGFB (proNGFB). Also acts as a receptor for neurotensin. May promote mineralization of the extracellular matrix during osteogenic differentiation by scavenging extracellular LPL. Probably required in adipocytes for the formation of specialized storage vesicles containing the glucose transporter SLC2A4/GLUT4 (GLUT4 storage vesicles, or GSVs). These vesicles provide a stable pool of SLC2A4 and confer increased responsiveness to insulin. May also mediate transport from the endoplasmic reticulum to the Golgi. {Experimental EvidencePubMed:10085125, Experimental EvidencePubMed:11331584, Experimental EvidencePubMed:11390366, Experimental EvidencePubMed:12209882, Experimental EvidencePubMed:12598608, Experimental EvidencePubMed:14657016, Experimental EvidencePubMed:14985763, Experimental EvidencePubMed:15313463, Experimental EvidencePubMed:15930396, Experimental EvidencePubMed:15987945, Experimental EvidencePubMed:16787399, Experimental EvidencePubMed:18817523}. | Assigned Ontology terms |
Biological Process | Endocytosis (GO:0006897) Endosome To Lysosome Transport (GO:0008333) Endosome Transport Via Multivesicular Body Sorting Pathway (GO:0032509) Extrinsic Apoptotic Signaling Pathway Via Death Domain Receptors (GO:0008625) G Protein-Coupled Receptor Signaling Pathway (GO:0007186) Glucose Import (GO:0046323) Golgi To Endosome Transport (GO:0006895) Golgi To Lysosome Transport (GO:0090160) Myotube Differentiation (GO:0014902) Negative Regulation Of Fat Cell Differentiation (GO:0045599) Negative Regulation Of Lipoprotein Lipase Activity (GO:0051005) Neuropeptide Signaling Pathway (GO:0007218) Neurotrophin TRK Receptor Signaling Pathway (GO:0048011) Ossification (GO:0001503) Plasma Membrane To Endosome Transport (GO:0048227) Post-Golgi Vesicle-Mediated Transport (GO:0006892) Protein Targeting To Lysosome (GO:0006622) Regulation Of Gene Expression (GO:0010468) Response To Insulin (GO:0032868) Vesicle Organization (GO:0016050) |
Molecular Function | Enzyme Binding (GO:0019899) Nerve Growth Factor Binding (GO:0048406) Nerve Growth Factor Receptor Activity (GO:0010465) Neurotensin Receptor Activity, Non-G Protein-Coupled (GO:0030379) Retromer Complex Binding (GO:1905394) |
Description |
|
---|---|
Note=A common polymorphism located in a non-coding region between CELSR2 and PSRC1 alters a CEBP transcription factor binding site and is responsible for changes in hepatic expression of SORT1. Altered SORT1 expression in liver affects low density lipoprotein cholesterol levels in plasma and is associated with susceptibility to myocardial infarction. {Experimental EvidencePubMed:20686566}. | Database Associations |
OMIM | 602458 613589 |
DisGeNET | 6272 |
Interactions with Nuclear Envelope proteins (9 interactors) |
|||
---|---|---|---|
Partner (NucEnvDB) | IntAct | Confidence score | |
Q99523 | Self | EBI-25396647 | 0.68 |
Q9UPY3 | Endoribonuclease Dicer | EBI-11154667 | 0.35 |
P03246 | E1B protein, small T-antigen | EBI-11722343 | 0.35 |
Q6PIV2 | Forkhead box protein R1 | EBI-11321774 | 0.35 |
Q8NC56 | LEM domain-containing protein 2 | EBI-11154667 | 0.35 |
Q86WG5 | Myotubularin-related protein 13 | EBI-11154667 | 0.35 |
Q16620 | BDNF/NT-3 growth factors receptor | EBI-9828457 | 0.44 |
Q63604 | BDNF/NT-3 growth factors receptor | EBI-9663445 | 0.43 |
Q92900 | Regulator of nonsense transcripts 1 | EBI-11154667 | 0.35 | Interactions with other proteins (163 interactors) |
Partner (UniProt) | IntAct | Confidence score | |
Q9UJY4 | ADP-ribosylation factor-binding protein GGA2 (Gamma-adaptin-related protein 2) (Golgi-localized, gamma ear-containing, ARF-binding protein 2) (VHS domain and ear domain of gamma-adaptin) (Vear) | EBI-7835669 | 0.70 |
Q9UJY5 | ADP-ribosylation factor-binding protein GGA1 (Gamma-adaptin-related protein 1) (Golgi-localized, gamma ear-containing, ARF-binding protein 1) | EBI-7866420 | 0.67 |
P24941 | Cyclin-dependent kinase 2 (EC 2.7.11.22) (Cell division protein kinase 2) (p33 protein kinase) | EBI-11154667 | 0.56 |
P28799 | Progranulin (PGRN) (Acrogranin) (Epithelin precursor) (Glycoprotein of 88 Kda) (GP88) (Glycoprotein 88) (Granulin precursor) (PC cell-derived growth factor) (PCDGF) (Proepithelin) (PEPI) [Cleaved into: Paragranulin; Granulin-1 (Granulin G); Granulin-2 (Granulin F); Granulin-3 (Epithelin-2) (Granulin B); Granulin-4 (Epithelin-1) (Granulin A); Granulin-5 (Granulin C); Granulin-6 (Granulin D); Granulin-7 (Granulin E)] | EBI-8759908 | 0.61 |
P11151 | Lipoprotein lipase (LPL) (EC 3.1.1.34) (Phospholipase A1) (EC 3.1.1.32) | EBI-8794584 | 0.66 |
P30533 | Alpha-2-macroglobulin receptor-associated protein (Alpha-2-MRAP) (Low density lipoprotein receptor-related protein-associated protein 1) (RAP) | EBI-8794629 | 0.81 |
P06858 | Lipoprotein lipase (LPL) (EC 3.1.1.34) (Phospholipase A1) (EC 3.1.1.32) | EBI-8795527 | 0.44 |
P01138 | Beta-nerve growth factor (Beta-NGF) | EBI-9253924 | 0.68 |
P30990 | Neurotensin/neuromedin N [Cleaved into: Large neuromedin N (NmN-125); Neuromedin N (NN) (NmN); Neurotensin (NT); Tail peptide] | EBI-25298265 | 0.70 |
P08138 | Tumor necrosis factor receptor superfamily member 16 (Gp80-LNGFR) (Low affinity neurotrophin receptor p75NTR) (Low-affinity nerve growth factor receptor) (NGF receptor) (p75 ICD) (CD antigen CD271) | EBI-9346945 | 0.40 |
Q8IVD9 | NudC domain-containing protein 3 | EBI-9395191 | 0.35 |
P54256 | Huntingtin-associated protein 1 (HAP-1) | EBI-9663445 | 0.43 |
Q16288 | NT-3 growth factor receptor (EC 2.7.10.1) (GP145-TrkC) (Trk-C) (Neurotrophic tyrosine kinase receptor type 3) (TrkC tyrosine kinase) | EBI-9827681 | 0.54 |
P04629 | High affinity nerve growth factor receptor (EC 2.7.10.1) (Neurotrophic tyrosine kinase receptor type 1) (TRK1-transforming tyrosine kinase protein) (Tropomyosin-related kinase A) (Tyrosine kinase receptor) (Tyrosine kinase receptor A) (Trk-A) (gp140trk) (p140-TrkA) | EBI-9827696 | 0.46 |
Q14653 | Interferon regulatory factor 3 (IRF-3) | EBI-11321946 | 0.35 |
P0CK56 | Uncharacterized protein BDLF4 | EBI-11725466 | 0.35 |
Q2MG95 | BVLF1 | EBI-11733653 | 0.35 |
Q8IXK0 | Polyhomeotic-like protein 2 (hPH2) (Early development regulatory protein 2) | EBI-11154667 | 0.35 |
Q7Z7F7 | 39S ribosomal protein L55, mitochondrial (L55mt) (MRP-L55) (Mitochondrial large ribosomal subunit protein bL31m) (Mitochondrial large ribosomal subunit protein mL55) | EBI-11154667 | 0.35 |
O43543 | DNA repair protein XRCC2 (X-ray repair cross-complementing protein 2) | EBI-11154667 | 0.35 |
Q8IZY2 | Phospholipid-transporting ATPase ABCA7 (EC 7.6.2.1) (ABCA-SSN) (ATP-binding cassette sub-family A member 7) (Autoantigen SS-N) (Macrophage ABC transporter) | EBI-11154667 | 0.35 |
Q6KCM7 | Calcium-binding mitochondrial carrier protein SCaMC-2 (Mitochondrial ATP-Mg/Pi carrier protein 3) (Mitochondrial Ca(2+)-dependent solute carrier protein 3) (Small calcium-binding mitochondrial carrier protein 2) (Solute carrier family 25 member 25) | EBI-11154667 | 0.35 |
Q8N8A6 | ATP-dependent RNA helicase DDX51 (EC 3.6.4.13) (DEAD box protein 51) | EBI-11154667 | 0.35 |
O95678 | Keratin, type II cytoskeletal 75 (Cytokeratin-75) (CK-75) (Keratin-6 hair follicle) (hK6hf) (Keratin-75) (K75) (Type II keratin-K6hf) (Type-II keratin Kb18) | EBI-11154667 | 0.35 |
Q6PKC3 | Thioredoxin domain-containing protein 11 (EF-hand-binding protein 1) | EBI-11154667 | 0.35 |
J3KP15 | Serine/arginine-rich splicing factor 2 (Splicing component, 35 kDa) (Splicing factor SC35) (Splicing factor, arginine/serine-rich 2) | EBI-11154667 | 0.35 |
Q9BQE3 | Tubulin alpha-1C chain (EC 3.6.5.-) (Alpha-tubulin 6) (Tubulin alpha-6 chain) [Cleaved into: Detyrosinated tubulin alpha-1C chain] | EBI-11154667 | 0.35 |
Q8IXQ6 | Protein mono-ADP-ribosyltransferase PARP9 (EC 2.4.2.-) (ADP-ribosyltransferase diphtheria toxin-like 9) (ARTD9) (B aggressive lymphoma protein) (Poly [ADP-ribose] polymerase 9) (PARP-9) | EBI-11154667 | 0.35 |
Q86YS7 | C2 domain-containing protein 5 (C2 domain-containing phosphoprotein of 138 kDa) | EBI-11154667 | 0.35 |
Q9H6R4 | Nucleolar protein 6 (Nucleolar RNA-associated protein) (Nrap) | EBI-11154667 | 0.35 |
G5E9A6 | Ubiquitin carboxyl-terminal hydrolase (EC 3.4.19.12) | EBI-11154667 | 0.35 |
Q9P0T7 | Proton-transporting V-type ATPase complex assembly regulator TMEM9 (v-ATPase assembly regulator TMEM9) (Dermal papilla-derived protein 4) (Transmembrane protein 9) (Protein TMEM9) | EBI-11154667 | 0.35 |
O43504 | Ragulator complex protein LAMTOR5 (Hepatitis B virus X-interacting protein) (HBV X-interacting protein) (HBX-interacting protein) (Late endosomal/lysosomal adaptor and MAPK and MTOR activator 5) | EBI-11154667 | 0.35 |
H3BS42 | Zinc finger protein 768 | EBI-11154667 | 0.35 |
Q96AY2 | Crossover junction endonuclease EME1 (EC 3.1.22.-) (MMS4 homolog) (hMMS4) | EBI-11154667 | 0.35 |
O43674 | NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial (Complex I-SGDH) (CI-SGDH) (NADH-ubiquinone oxidoreductase SGDH subunit) | EBI-11154667 | 0.35 |
Q9UHR4 | Brain-specific angiogenesis inhibitor 1-associated protein 2-like protein 1 (BAI1-associated protein 2-like protein 1) (Insulin receptor tyrosine kinase substrate) | EBI-11154667 | 0.35 |
Q9H2D6 | TRIO and F-actin-binding protein (Protein Tara) (Trio-associated repeat on actin) | EBI-11154667 | 0.35 |
Q9BXF6 | Rab11 family-interacting protein 5 (Rab11-FIP5) (Gamma-SNAP-associated factor 1) (Gaf-1) (Phosphoprotein pp75) (Rab11-interacting protein Rip11) | EBI-11154667 | 0.35 |
H3BNT4 | M-phase phosphoprotein 6 | EBI-11154667 | 0.35 |
P78368 | Casein kinase I isoform gamma-2 (CKI-gamma 2) (EC 2.7.11.1) | EBI-11154667 | 0.35 |
Q6T4R5 | Actin remodeling regulator NHS (Congenital cataracts and dental anomalies protein) (Nance-Horan syndrome protein) | EBI-11154667 | 0.35 |
Q9Y2H6 | Fibronectin type-III domain-containing protein 3A (Human gene expressed in odontoblasts) | EBI-11154667 | 0.35 |
Q8IWU2 | Serine/threonine-protein kinase LMTK2 (EC 2.7.11.1) (Apoptosis-associated tyrosine kinase 2) (Brain-enriched kinase) (hBREK) (CDK5/p35-regulated kinase) (CPRK) (Kinase/phosphatase/inhibitor 2) (Lemur tyrosine kinase 2) (Serine/threonine-protein kinase KPI-2) | EBI-11154667 | 0.35 |
Q86WP2 | Vasculin (GC-rich promoter-binding protein 1) (Vascular wall-linked protein) | EBI-11154667 | 0.35 |
Q9Y6X9 | ATPase MORC2 (EC 3.6.1.-) (MORC family CW-type zinc finger protein 2) (Zinc finger CW-type coiled-coil domain protein 1) | EBI-11154667 | 0.35 |
Q14684 | Ribosomal RNA processing protein 1 homolog B (RRP1-like protein B) | EBI-11154667 | 0.35 |
Q9BZF9 | Uveal autoantigen with coiled-coil domains and ankyrin repeats | EBI-11154667 | 0.35 |
Q7Z7K6 | Centromere protein V (CENP-V) (Nuclear protein p30) (Proline-rich protein 6) | EBI-11154667 | 0.35 |
P12882 | Myosin-1 (Myosin heavy chain 1) (Myosin heavy chain 2x) (MyHC-2x) (Myosin heavy chain IIx/d) (MyHC-IIx/d) (Myosin heavy chain, skeletal muscle, adult 1) | EBI-11154667 | 0.35 |
Q8N8R5 | Mitochondrial protein C2orf69 | EBI-11154667 | 0.35 |
G5E9S8 | Kinesin light chain | EBI-11154667 | 0.35 |
P98170 | E3 ubiquitin-protein ligase XIAP (EC 2.3.2.27) (Baculoviral IAP repeat-containing protein 4) (IAP-like protein) (ILP) (hILP) (Inhibitor of apoptosis protein 3) (IAP-3) (hIAP-3) (hIAP3) (RING-type E3 ubiquitin transferase XIAP) (X-linked inhibitor of apoptosis protein) (X-linked IAP) | EBI-11154667 | 0.35 |
O94782 | Ubiquitin carboxyl-terminal hydrolase 1 (EC 3.4.19.12) (Deubiquitinating enzyme 1) (hUBP) (Ubiquitin thioesterase 1) (Ubiquitin-specific-processing protease 1) [Cleaved into: Ubiquitin carboxyl-terminal hydrolase 1, N-terminal fragment] | EBI-11154667 | 0.35 |
Q9H792 | Inactive tyrosine-protein kinase PEAK1 (Pseudopodium-enriched atypical kinase 1) (Sugen kinase 269) (Tyrosine-protein kinase SgK269) | EBI-11154667 | 0.35 |
Q92934 | Bcl2-associated agonist of cell death (BAD) (Bcl-2-binding component 6) (Bcl-2-like protein 8) (Bcl2-L-8) (Bcl-xL/Bcl-2-associated death promoter) (Bcl2 antagonist of cell death) | EBI-11154667 | 0.35 |
P06493 | Cyclin-dependent kinase 1 (CDK1) (EC 2.7.11.22) (EC 2.7.11.23) (Cell division control protein 2 homolog) (Cell division protein kinase 1) (p34 protein kinase) | EBI-11154667 | 0.35 |
Q9NYU1 | UDP-glucose:glycoprotein glucosyltransferase 2 (UGT2) (hUGT2) (EC 2.4.1.-) (UDP--Glc:glycoprotein glucosyltransferase 2) (UDP-glucose ceramide glucosyltransferase-like 1) | EBI-11154667 | 0.35 |
E9PRI1 | Crossover junction endonuclease MUS81 (EC 3.1.22.-) | EBI-11154667 | 0.35 |
O00308 | NEDD4-like E3 ubiquitin-protein ligase WWP2 (EC 2.3.2.26) (Atrophin-1-interacting protein 2) (AIP2) (HECT-type E3 ubiquitin transferase WWP2) (WW domain-containing protein 2) | EBI-11154667 | 0.35 |
Q9NP74 | Palmdelphin (Paralemmin-like protein) | EBI-11154667 | 0.35 |
O60506 | Heterogeneous nuclear ribonucleoprotein Q (hnRNP Q) (Glycine- and tyrosine-rich RNA-binding protein) (GRY-RBP) (NS1-associated protein 1) (Synaptotagmin-binding, cytoplasmic RNA-interacting protein) | EBI-11154667 | 0.35 |
Q16222 | UDP-N-acetylhexosamine pyrophosphorylase (Antigen X) (AGX) (Sperm-associated antigen 2) [Includes: UDP-N-acetylgalactosamine pyrophosphorylase (EC 2.7.7.83) (AGX-1); UDP-N-acetylglucosamine pyrophosphorylase (EC 2.7.7.23) (AGX-2)] | EBI-11154667 | 0.35 |
Q9NW13 | RNA-binding protein 28 (RNA-binding motif protein 28) | EBI-11154667 | 0.35 |
O15020 | Spectrin beta chain, non-erythrocytic 2 (Beta-III spectrin) (Spinocerebellar ataxia 5 protein) | EBI-11154667 | 0.35 |
Q8WW22 | DnaJ homolog subfamily A member 4 | EBI-11154667 | 0.35 |
Q15646 | 2'-5'-oligoadenylate synthase-like protein (2'-5'-OAS-related protein) (2'-5'-OAS-RP) (59 kDa 2'-5'-oligoadenylate synthase-like protein) (Thyroid receptor-interacting protein 14) (TR-interacting protein 14) (TRIP-14) (p59 OASL) (p59OASL) | EBI-11154667 | 0.35 |
Q8TED0 | U3 small nucleolar RNA-associated protein 15 homolog | EBI-11154667 | 0.35 |
Q6PCT2 | F-box/LRR-repeat protein 19 (F-box and leucine-rich repeat protein 19) | EBI-11154667 | 0.35 |
Q13867 | Bleomycin hydrolase (BH) (BLM hydrolase) (BMH) (EC 3.4.22.40) | EBI-11154667 | 0.35 |
P07437 | Tubulin beta chain (Tubulin beta-5 chain) | EBI-11154667 | 0.35 |
G3V5I9 | CMT1A duplicated region transcript 4 protein | EBI-11154667 | 0.35 |
P00738 | Haptoglobin (Zonulin) [Cleaved into: Haptoglobin alpha chain; Haptoglobin beta chain] | EBI-11154667 | 0.35 |
P46087 | Probable 28S rRNA (cytosine(4447)-C(5))-methyltransferase (EC 2.1.1.-) (Nucleolar protein 1) (Nucleolar protein 2 homolog) (Proliferating-cell nucleolar antigen p120) (Proliferation-associated nucleolar protein p120) | EBI-11154667 | 0.35 |
Q9Y2L1 | Exosome complex exonuclease RRP44 (EC 3.1.13.-) (EC 3.1.26.-) (Protein DIS3 homolog) (Ribosomal RNA-processing protein 44) | EBI-11154667 | 0.35 |
Q8TDN6 | Ribosome biogenesis protein BRX1 homolog (Brix domain-containing protein 2) | EBI-11154667 | 0.35 |
O60287 | Nucleolar pre-ribosomal-associated protein 1 (Nucleolar protein 254 kDa) (URB1 ribosome biogenesis 1 homolog) | EBI-11154667 | 0.35 |
H0YAJ5 | Amyloid beta precursor protein-binding family B member 2 | EBI-11154667 | 0.35 |
Q96MF7 | E3 SUMO-protein ligase NSE2 (EC 2.3.2.-) (E3 SUMO-protein transferase NSE2) (MMS21 homolog) (hMMS21) (Non-structural maintenance of chromosomes element 2 homolog) (Non-SMC element 2 homolog) | EBI-11154667 | 0.35 |
P67809 | Y-box-binding protein 1 (YB-1) (CCAAT-binding transcription factor I subunit A) (CBF-A) (DNA-binding protein B) (DBPB) (Enhancer factor I subunit A) (EFI-A) (Nuclease-sensitive element-binding protein 1) (Y-box transcription factor) | EBI-11154667 | 0.35 |
Q9Y4E8 | Ubiquitin carboxyl-terminal hydrolase 15 (EC 3.4.19.12) (Deubiquitinating enzyme 15) (Ubiquitin thioesterase 15) (Ubiquitin-specific-processing protease 15) (Unph-2) (Unph4) | EBI-11154667 | 0.35 |
P53621 | Coatomer subunit alpha (Alpha-coat protein) (Alpha-COP) (HEP-COP) (HEPCOP) [Cleaved into: Xenin (Xenopsin-related peptide); Proxenin] | EBI-11154667 | 0.35 |
A7KAX9 | Rho GTPase-activating protein 32 (Brain-specific Rho GTPase-activating protein) (GAB-associated Cdc42/Rac GTPase-activating protein) (GC-GAP) (GTPase regulator interacting with TrkA) (Rho-type GTPase-activating protein 32) (Rho/Cdc42/Rac GTPase-activating protein RICS) (RhoGAP involved in the beta-catenin-N-cadherin and NMDA receptor signaling) (p200RhoGAP) (p250GAP) | EBI-11154667 | 0.35 |
Q96A35 | 39S ribosomal protein L24, mitochondrial (L24mt) (MRP-L24) (Mitochondrial large ribosomal subunit protein uL24m) | EBI-11154667 | 0.35 |
Q9NXA8 | NAD-dependent protein deacylase sirtuin-5, mitochondrial (EC 2.3.1.-) (Regulatory protein SIR2 homolog 5) (SIR2-like protein 5) | EBI-11154667 | 0.35 |
Q8IY21 | Probable ATP-dependent RNA helicase DDX60 (EC 3.6.4.13) (DEAD box protein 60) | EBI-11154667 | 0.35 |
G4U4J3 | PAP associated domain containing 5 | EBI-11154667 | 0.35 |
P42680 | Tyrosine-protein kinase Tec (EC 2.7.10.2) | EBI-11154667 | 0.35 |
Q08378 | Golgin subfamily A member 3 (Golgi complex-associated protein of 170 kDa) (GCP170) (Golgin-160) | EBI-11154667 | 0.35 |
Q8NCE0 | tRNA-splicing endonuclease subunit Sen2 (EC 4.6.1.16) (tRNA-intron endonuclease Sen2) (HsSen2) | EBI-11154667 | 0.35 |
P07949 | Proto-oncogene tyrosine-protein kinase receptor Ret (EC 2.7.10.1) (Cadherin family member 12) (Proto-oncogene c-Ret) [Cleaved into: Soluble RET kinase fragment; Extracellular cell-membrane anchored RET cadherin 120 kDa fragment] | EBI-11154667 | 0.35 |
Q6IN84 | rRNA methyltransferase 1, mitochondrial (EC 2.1.1.-) (16S rRNA (guanosine(1145)-2'-O)-methyltransferase) (16S rRNA [Gm1145] 2'-O-methyltransferase) | EBI-11154667 | 0.35 |
Q13428 | Treacle protein (Treacher Collins syndrome protein) | EBI-11154667 | 0.35 |
P51659 | Peroxisomal multifunctional enzyme type 2 (MFE-2) (17-beta-hydroxysteroid dehydrogenase 4) (17-beta-HSD 4) (D-bifunctional protein) (DBP) (Multifunctional protein 2) (MFP-2) (Short chain dehydrogenase/reductase family 8C member 1) [Cleaved into: (3R)-hydroxyacyl-CoA dehydrogenase (EC 1.1.1.n12); Enoyl-CoA hydratase 2 (EC 4.2.1.107) (EC 4.2.1.119) (3-alpha,7-alpha,12-alpha-trihydroxy-5-beta-cholest-24-enoyl-CoA hydratase)] | EBI-11154667 | 0.35 |
C9J6P4 | Zinc finger CCCH-type antiviral protein 1 | EBI-11154667 | 0.35 |
Q659A1 | Little elongation complex subunit 2 (Interactor of little elongator complex ELL subunit 2) (NMDA receptor-regulated protein 2) | EBI-11154667 | 0.35 |
Q6L8Q7 | 2',5'-phosphodiesterase 12 (2'-PDE) (2-PDE) (EC 3.1.4.-) (Mitochondrial deadenylase) (EC 3.1.13.4) | EBI-11154667 | 0.35 |
Q14146 | Unhealthy ribosome biogenesis protein 2 homolog | EBI-11154667 | 0.35 |
Q14232 | Translation initiation factor eIF-2B subunit alpha (eIF-2B GDP-GTP exchange factor subunit alpha) | EBI-11154667 | 0.35 |
P00966 | Argininosuccinate synthase (EC 6.3.4.5) (Citrulline--aspartate ligase) | EBI-11154667 | 0.35 |
J3KNB8 | Mitogen-activated protein kinase kinase kinase 4 | EBI-11154667 | 0.35 |
A1X283 | SH3 and PX domain-containing protein 2B (Adapter protein HOFI) (Factor for adipocyte differentiation 49) (Tyrosine kinase substrate with four SH3 domains) | EBI-11154667 | 0.35 |
Q9Y2U9 | Kelch domain-containing protein 2 (Hepatocellular carcinoma-associated antigen 33) (Host cell factor homolog LCP) (Host cell factor-like protein 1) (HCLP-1) | EBI-11154667 | 0.35 |
P51153 | Ras-related protein Rab-13 (Cell growth-inhibiting gene 4 protein) | EBI-11154667 | 0.35 |
Q53SF7 | Cordon-bleu protein-like 1 | EBI-11154667 | 0.35 |
Q96CS3 | FAS-associated factor 2 (Protein ETEA) (UBX domain-containing protein 3B) (UBX domain-containing protein 8) | EBI-11154667 | 0.35 |
Q01970 | 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3 (EC 3.1.4.11) (Phosphoinositide phospholipase C-beta-3) (Phospholipase C-beta-3) (PLC-beta-3) | EBI-11154667 | 0.35 |
Q92733 | Proline-rich protein PRCC (Papillary renal cell carcinoma translocation-associated gene protein) | EBI-11154667 | 0.35 |
Q8IYD8 | Fanconi anemia group M protein (Protein FACM) (EC 3.6.4.13) (ATP-dependent RNA helicase FANCM) (Fanconi anemia-associated polypeptide of 250 kDa) (FAAP250) (Protein Hef ortholog) | EBI-11154667 | 0.35 |
P13533 | Myosin-6 (Myosin heavy chain 6) (Myosin heavy chain, cardiac muscle alpha isoform) (MyHC-alpha) | EBI-11154667 | 0.35 |
Q6UVK1 | Chondroitin sulfate proteoglycan 4 (Chondroitin sulfate proteoglycan NG2) (Melanoma chondroitin sulfate proteoglycan) (Melanoma-associated chondroitin sulfate proteoglycan) | EBI-11154667 | 0.35 |
Q9UHL9 | General transcription factor II-I repeat domain-containing protein 1 (GTF2I repeat domain-containing protein 1) (General transcription factor III) (MusTRD1/BEN) (Muscle TFII-I repeat domain-containing protein 1) (Slow-muscle-fiber enhancer-binding protein) (USE B1-binding protein) (Williams-Beuren syndrome chromosomal region 11 protein) (Williams-Beuren syndrome chromosomal region 12 protein) | EBI-11154667 | 0.35 |
P42356 | Phosphatidylinositol 4-kinase alpha (PI4-kinase alpha) (PI4K-alpha) (PtdIns-4-kinase alpha) (EC 2.7.1.67) (Phosphatidylinositol 4-Kinase III alpha) | EBI-11154667 | 0.35 |
Q5JRA6 | Transport and Golgi organization protein 1 homolog (TANGO1) (C219-reactive peptide) (D320) (Melanoma inhibitory activity protein 3) | EBI-11154667 | 0.35 |
Q71F56 | Mediator of RNA polymerase II transcription subunit 13-like (Mediator complex subunit 13-like) (Thyroid hormone receptor-associated protein 2) (Thyroid hormone receptor-associated protein complex 240 kDa component-like) | EBI-11154667 | 0.35 |
P54577 | Tyrosine--tRNA ligase, cytoplasmic (EC 6.1.1.1) (Tyrosyl-tRNA synthetase) (TyrRS) [Cleaved into: Tyrosine--tRNA ligase, cytoplasmic, N-terminally processed] | EBI-11154667 | 0.35 |
Q8TE77 | Protein phosphatase Slingshot homolog 3 (EC 3.1.3.16) (EC 3.1.3.48) (SSH-like protein 3) (SSH-3L) (hSSH-3L) | EBI-11154667 | 0.35 |
Q8ND56 | Protein LSM14 homolog A (Protein FAM61A) (Protein SCD6 homolog) (Putative alpha-synuclein-binding protein) (AlphaSNBP) (RNA-associated protein 55A) (hRAP55) (hRAP55A) | EBI-11154667 | 0.35 |
Q8NFA0 | Ubiquitin carboxyl-terminal hydrolase 32 (EC 3.4.19.12) (Deubiquitinating enzyme 32) (Renal carcinoma antigen NY-REN-60) (Ubiquitin thioesterase 32) (Ubiquitin-specific-processing protease 32) | EBI-11154667 | 0.35 |
Q9Y490 | Talin-1 | EBI-11154667 | 0.35 |
Q9UMF0 | Intercellular adhesion molecule 5 (ICAM-5) (Telencephalin) | EBI-11154667 | 0.35 |
Q96P70 | Importin-9 (Imp9) (Ran-binding protein 9) (RanBP9) | EBI-11154667 | 0.35 |
Q7Z2E3 | Aprataxin (EC 3.6.1.71) (EC 3.6.1.72) (Forkhead-associated domain histidine triad-like protein) (FHA-HIT) | EBI-11154667 | 0.35 |
Q9NQY0 | Bridging integrator 3 | EBI-11154667 | 0.35 |
Q9NUQ7 | Ufm1-specific protease 2 (UfSP2) (EC 3.4.22.-) | EBI-11154667 | 0.35 |
Q13488 | V-type proton ATPase 116 kDa subunit a 3 (V-ATPase 116 kDa subunit a 3) (Osteoclastic proton pump 116 kDa subunit) (OC-116 kDa) (OC116) (T-cell immune regulator 1) (T-cell immune response cDNA7 protein) (TIRC7) (Vacuolar proton translocating ATPase 116 kDa subunit a isoform 3) | EBI-11154667 | 0.35 |
Q96A73 | Putative monooxygenase p33MONOX (EC 1.-.-.-) (Brain-derived rescue factor p60MONOX) (Flavin monooxygenase motif-containing protein of 33 kDa) | EBI-11154667 | 0.35 |
P43307 | Translocon-associated protein subunit alpha (TRAP-alpha) (Signal sequence receptor subunit alpha) (SSR-alpha) | EBI-11154667 | 0.35 |
Q92520 | Protein FAM3C (Interleukin-like EMT inducer) | EBI-22754816 | 0.56 |
O95183 | Vesicle-associated membrane protein 5 (VAMP-5) (Myobrevin) | EBI-22756180 | 0.56 |
Q6PL45 | BRICHOS domain-containing protein 5 | EBI-25279435 | 0.56 |
Q8TBE1 | Protein cornichon homolog 3 (CNIH-3) (Cornichon family AMPA receptor auxiliary protein 3) | EBI-24650011 | 0.56 |
P02787 | Serotransferrin (Transferrin) (Beta-1 metal-binding globulin) (Siderophilin) | EBI-24758574 | 0.56 |
P23560 | Brain-derived neurotrophic factor (BDNF) (Abrineurin) [Cleaved into: BDNF precursor form (ProBDNF)] | EBI-24760183 | 0.56 |
Q96K78 | Adhesion G-protein coupled receptor G7 (G-protein coupled receptor 128) | EBI-25271609 | 0.56 |
Q20MH8 | Matrix protein 2 (Proton channel protein M2) | EBI-12586258 | 0.35 |
Q15077 | P2Y purinoceptor 6 (P2Y6) | EBI-21272198 | 0.35 |
P05067 | Amyloid-beta precursor protein (APP) (ABPP) (APPI) (Alzheimer disease amyloid A4 protein homolog) (Alzheimer disease amyloid protein) (Amyloid precursor protein) (Amyloid-beta (A4) precursor protein) (Amyloid-beta A4 protein) (Cerebral vascular amyloid peptide) (CVAP) (PreA4) (Protease nexin-II) (PN-II) [Cleaved into: N-APP; Soluble APP-alpha (S-APP-alpha); Soluble APP-beta (S-APP-beta); C99 (Beta-secretase C-terminal fragment) (Beta-CTF); Amyloid-beta protein 42 (Abeta42) (Beta-APP42); Amyloid-beta protein 40 (Abeta40) (Beta-APP40); C83 (Alpha-secretase C-terminal fragment) (Alpha-CTF); P3(42); P3(40); C80; Gamma-secretase C-terminal fragment 59 (Amyloid intracellular domain 59) (AICD-59) (AID(59)) (Gamma-CTF(59)); Gamma-secretase C-terminal fragment 57 (Amyloid intracellular domain 57) (AICD-57) (AID(57)) (Gamma-CTF(57)); Gamma-secretase C-terminal fragment 50 (Amyloid intracellular domain 50) (AICD-50) (AID(50)) (Gamma-CTF(50)); C31] | EBI-21183114 | 0.54 |
P26441 | Ciliary neurotrophic factor (CNTF) | EBI-25298162 | 0.57 |
Q9UBD9 | Cardiotrophin-like cytokine factor 1 (B-cell-stimulating factor 3) (BSF-3) (Novel neurotrophin-1) (NNT-1) | EBI-25298249 | 0.40 |
O75462 | Cytokine receptor-like factor 1 (Cytokine-like factor 1) (CLF-1) (ZcytoR5) | EBI-25298249 | 0.40 |
P83714 | Cardiotrophin-2 (CT-2) (Neuropoietin) (Np) | EBI-25298290 | 0.54 |
Q16619 | Cardiotrophin-1 (CT-1) | EBI-25298330 | 0.44 |
P15018 | Leukemia inhibitory factor (LIF) (Differentiation-stimulating factor) (D factor) (Melanoma-derived LPL inhibitor) (MLPLI) (Emfilermin) | EBI-25298341 | 0.44 |
P13725 | Oncostatin-M (OSM) | EBI-25298353 | 0.44 |
P42702 | Leukemia inhibitory factor receptor (LIF receptor) (LIF-R) (CD antigen CD118) | EBI-25298362 | 0.51 |
P05231 | Interleukin-6 (IL-6) (B-cell stimulatory factor 2) (BSF-2) (CTL differentiation factor) (CDF) (Hybridoma growth factor) (Interferon beta-2) (IFN-beta-2) | EBI-25396627 | 0.57 |
P01580 | Interferon gamma (IFN-gamma) | EBI-25396634 | 0.44 |
Q9JLC4 | VPS10 domain-containing receptor SorCS1 (mSorCS) | EBI-25300430 | 0.54 |
Q8WY21 | VPS10 domain-containing receptor SorCS1 (hSorCS) | EBI-25300575 | 0.54 |
P06280 | Alpha-galactosidase A (EC 3.2.1.22) (Alpha-D-galactosidase A) (Alpha-D-galactoside galactohydrolase) (Galactosylgalactosylglucosylceramidase GLA) (Melibiase) (Agalsidase) | EBI-25396912 | 0.59 |
P01266 | Thyroglobulin (Tg) | EBI-25406637 | 0.54 |
P06882 | Thyroglobulin (Tg) | EBI-25406672 | 0.54 |
P20068 | Neurotensin/neuromedin N [Cleaved into: Large neuromedin N (NmN-125); Neuromedin N (NN) (NmN); Neurotensin (NT); Tail peptide] | EBI-25406716 | 0.40 |
P01267 | Thyroglobulin (Tg) | EBI-25408014 | 0.40 |
O96028 | Histone-lysine N-methyltransferase NSD2 (EC 2.1.1.357) (Multiple myeloma SET domain-containing protein) (MMSET) (Nuclear SET domain-containing protein 2) (Protein trithorax-5) (Wolf-Hirschhorn syndrome candidate 1 protein) | EBI-25486814 | 0.35 |
P0DTD8 | ORF7b protein (ORF7b) (Accessory protein 7b) | EBI-25687199 | 0.35 |
Q7TFA1 | Protein non-structural 7b (ns7b) (Accessory protein 7b) | EBI-25688644 | 0.35 |
Q9UBQ0 | Vacuolar protein sorting-associated protein 29 (hVPS29) (PEP11 homolog) (Vesicle protein sorting 29) | EBI-25890950 | 0.56 |
Q13363 | C-terminal-binding protein 1 (CtBP1) (EC 1.1.1.-) | EBI-27045766 | 0.35 |
Q8IV63 | Inactive serine/threonine-protein kinase VRK3 (Serine/threonine-protein pseudokinase VRK3) (Vaccinia-related kinase 3) | EBI-28942353 | 0.35 |
Q96KG9 | N-terminal kinase-like protein (Coated vesicle-associated kinase of 90 kDa) (SCY1-like protein 1) (Telomerase regulation-associated protein) (Telomerase transcriptional element-interacting factor) (Teratoma-associated tyrosine kinase) | EBI-28944481 | 0.35 |
Q92932 | Receptor-type tyrosine-protein phosphatase N2 (R-PTP-N2) (EC 3.1.3.-) (EC 3.1.3.48) (Islet cell autoantigen-related protein) (IAR) (ICAAR) (Phogrin) [Cleaved into: IA-2beta60] | EBI-27115082 | 0.35 |
Database | Links |
UNIPROT | Q99523 B4DWI3 C0JYZ0 Q8IZ49 |
PDB | 3F6K 3G2U 3G2V 4MSL 4N7E 4PO7 5MRH 5MRI 6EHO 6X3L 6X48 6X4H |
Pfam | PF15902 PF15901 |
OMIM | 602458 613589 |
DisGeNET | 6272 |