NucEnvDB

NucEnvDB

A database of Nuclear Envelope Proteins and their Interactions

Leupaxin - Mus musculus - NucEnvDB

Leupaxin (Mus musculus)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	Leupaxin
Accession Code	Q99N69
Gene	Lpxn
Organism	Mus musculus \| House mouse (Taxonomy: 10090)
Part of Reference Proteome?	Yes
Sequence (Length: 386)
MEELDALLEELERCTFQDSEEYSNPVSCHLDQQSTEESKIPQTPKTLSSQGNTSPLKVQLVYATNIQEPNVYSEVQEPKESVLPPKTSAAAQLDELMAHLSEMQAKVSVKADTSRKPLPDQQDHKASLDS MLGDLEQELQDLGIATVPKGYCASCQKPIAGKVIHALGQSWHPEHFVCTHCKEELGSSPFFERSGLAYCSKDYHRLFSPRCAYCAAPITDKVLTAMNKTWHPEHFFCSHCGEVFGAEGFHEKDKKPYCRK DFLAMFSPKCGGCNRPVLENYLSAMNTVWHPECFVCGDCFSSFSSGSFFELDGRPFCELHYHHRRGTLCHDCGQPITGRCISAMGHKFHPEHFVCAFCLTQLPKGIFKEQNNKTYCEKCFTKLFSQ

Subcellular Location

Description
Cytoplasm {By Similarity}. Cell junction, focal adhesion. Nucleus. Cytoplasm, perinuclear region. Cell projection, podosome. Cell membrane. Note=Shuttles between the cytoplasm and nucleus. Recruited to the cell membrane following B-cell antigen receptor (BCR) cross-linking in B-cells. Enhanced focal adhesion kinase activity (PTK2/FAK) attenuates its nuclear accumulation and limits its ability to enhance serum response factor (SRF)-dependent gene transcription. Targeting to focal adhesions is essential for its tyrosine phosphorylation in response to bombesin (By similarity). {By Similarity}.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Unknown	UniProt	Sequence Analysis
Assigned Ontology terms

Cellular Component	Cell Projection (GO:0042995) Cytoplasm (GO:0005737) Cytosol (GO:0005829) Focal Adhesion (GO:0005925) Nuclear Speck (GO:0016607) Nucleus (GO:0005634) Perinuclear Region Of Cytoplasm (GO:0048471) Plasma Membrane (GO:0005886) Podosome (GO:0002102)

Biology & Function

Description
Transcriptional coactivator for androgen receptor (AR) and serum response factor (SRF). Contributes to the regulation of cell adhesion, spreading and cell migration and acts as a negative regulator in integrin-mediated cell adhesion events. Suppresses the integrin- induced tyrosine phosphorylation of paxillin (PXN). May play a critical role as an adapter protein in the formation of the adhesion zone in osteoclasts. Negatively regulates B-cell antigen receptor (BCR) signaling. {Experimental EvidencePubMed:12674328, Experimental EvidencePubMed:17640867, Experimental EvidencePubMed:18497331, Experimental EvidencePubMed:19917054}.
Assigned Ontology terms

Biological Process	Endothelial Cell Migration (GO:0043542) Negative Regulation Of B Cell Receptor Signaling Pathway (GO:0050859) Negative Regulation Of Cell Adhesion (GO:0007162) Regulation Of Cell Adhesion Mediated By Integrin (GO:0033628) Substrate Adhesion-Dependent Cell Spreading (GO:0034446) Transforming Growth Factor Beta Receptor Signaling Pathway (GO:0007179)
Molecular Function	Metal Ion Binding (GO:0046872) Transcription Coregulator Activity (GO:0003712)

Protein-Protein Interactions

Interactions with other proteins (2 interactors)

Partner (UniProt)		IntAct	Confidence score
Q62406	Interleukin-1 receptor-associated kinase 1 (IRAK) (IRAK-1) (EC 2.7.11.1) (Pelle-like protein kinase) (mPLK)	EBI-658892	0.37
A0A0F6AW51	MAPK phosphothreonine lyase (Secreted effector protein SpvC)	EBI-13950465	0.40

Cross-References

Database	Links
UNIPROT	Q99N69
Pfam	PF00412
PROSITE	PS00478 PS50023

Powered by W3.css | Privacy Notice

x

This website uses cookies to improve user experience. By using NucEnvDB you consent to all cookies in accordance with our privacy policy. OK