TNF receptor-associated factor 4 - Homo sapiens

TNF receptor-associated factor 4 (Homo sapiens)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	TNF receptor-associated factor 4
Accession Code	Q9BUZ4
Gene	TRAF4
Organism	Homo sapiens \| Human (Taxonomy: 9606)
Part of Reference Proteome?	Yes
Sequence (Length: 470)
MPGFDYKFLEKPKRRLLCPLCGKPMREPVQVSTCGHRFCDTCLQEFLSEGVFKCPEDQLPLDYAKIYPDPELEVQVLGLP IRCIHSEEGCRWSGPLRHLQGHLNTCSFNVIPCPNRCPMKLSRRDLPAHLQHDCPKRRLKCEFCGCDFSGEAYESHEGMC PQESVYCENKCGARMMRRLLAQHATSECPKRTQPCTYCTKEFVFDTIQSHQYQCPRLPVACPNQCGVGTVAREDLPGHLK DSCNTALVLCPFKDSGCKHRCPKLAMARHVEESVKPHLAMMCALVSRQRQELQELRRELEELSVGSDGVLIWKIGSYGRR LQEAKAKPNLECFSPAFYTHKYGYKLQVSAFLNGNGSGEGTHLSLYIRVLPGAFDNLLEWPFARRVTFSLLDQSDPGLAK PQHVTETFHPDPNWKNFQKPGTWRGSLDESSLGFGYPKFISHQDIRKRNYVRDDAVFIRAAVELPRKILS

Structure Viewer (PDB: 3ZJB)

Subcellular Location

Description
Cytoplasm {Experimental EvidencePubMed:32268273}. Nucleus {Experimental EvidencePubMed:32268273}. Cytoplasm, perinuclear region. Cell junction, tight junction. Cell membrane; Peripheral membrane protein; Cytoplasmic side. Cytoplasm, cytoskeleton {ECO:0000305}.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Peripheral	UniProt	Sequence Analysis
Assigned Ontology terms

Cellular Component	Bicellular Tight Junction (GO:0005923) Cytoplasm (GO:0005737) Cytoskeleton (GO:0005856) Cytosol (GO:0005829) Fibrillar Center (GO:0001650) Nucleoplasm (GO:0005654) Nucleus (GO:0005634) Perinuclear Region Of Cytoplasm (GO:0048471) Plasma Membrane (GO:0005886)

Biology & Function

Description
Adapter protein with E3 ligase activity that is involved in many diverse biological processes including cell proliferation, migration, differentiation, DNA repair, platelet activation or apoptosis (PubMed:30352854, PubMed:31076633, PubMed:32268273, PubMed:33991522). Promotes EGFR-mediated signaling by facilitating the dimerization of EGFR and downstream AKT activation thereby promoting cell proliferation (PubMed:30352854). Ubiquitinates SMURF2 through 'Lys-48'-linked ubiquitin chain leading to SMURF2 degradation through the proteasome and subsequently osteogenic differentiation (PubMed:31076633). Promotes 'Lys-63'-mediated ubiquitination of CHK1 which in turn activates cell cycle arrest and activation of DNA repair (PubMed:32357935). In addition, promotes an atypical 'Lys-29'-linked ubiquitination at the C-terminal end of IRS1 which is crucial for insulin-like growth factor (IGF) signal transduction (PubMed:33991522). Regulates activation of NF-kappa-B in response to signaling through Toll-like receptors. Required for normal skeleton development, and for normal development of the respiratory tract (By similarity). Required for activation of RPS6KB1 in response to TNF signaling. Modulates TRAF6 functions. Inhibits adipogenic differentiation by activating pyruvate kinase PKM activity and subsequently the beta-catenin signaling pathway (PubMed:32268273). {By Similarity, Experimental EvidencePubMed:12023963, Experimental EvidencePubMed:12801526, Experimental EvidencePubMed:16052631, Experimental EvidencePubMed:16157600, Experimental EvidencePubMed:18953416, Experimental EvidencePubMed:19937093, Experimental EvidencePubMed:30352854, Experimental EvidencePubMed:31076633, Experimental EvidencePubMed:32268273, Experimental EvidencePubMed:32357935, Experimental EvidencePubMed:33991522}.
Assigned Ontology terms

Biological Process	Activation Of NF-KappaB-Inducing Kinase Activity (GO:0007250) Apoptotic Process (GO:0006915) Innate Immune Response (GO:0045087) Positive Regulation Of JNK Cascade (GO:0046330) Positive Regulation Of Protein Kinase Activity (GO:0045860) Proteasome-Mediated Ubiquitin-Dependent Protein Catabolic Process (GO:0043161) Regulation Of Apoptotic Process (GO:0042981) Regulation Of I-KappaB Kinase/NF-KappaB Signaling (GO:0043122) Respiratory Gaseous Exchange By Respiratory System (GO:0007585) Respiratory Tube Development (GO:0030323)
Molecular Function	Identical Protein Binding (GO:0042802) Protein Kinase Binding (GO:0019901) Thioesterase Binding (GO:0031996) Transferase Activity (GO:0016740) Tumor Necrosis Factor Receptor Binding (GO:0005164) Ubiquitin Protein Ligase Binding (GO:0031625) WW Domain Binding (GO:0050699) Zinc Ion Binding (GO:0008270)

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (7 interactors)

Partner (NucEnvDB)		IntAct	Confidence score
Q9BUZ4	Self	EBI-10487421	0.76
Q13625	Apoptosis-stimulating of p53 protein 2	EBI-10299140	0.56
Q14289	Protein-tyrosine kinase 2-beta	EBI-21980067	0.35
Q9NRD5	PRKCA-binding protein	EBI-24332833	0.56
P14335	RNA-directed RNA polymerase NS5	EBI-11423759	0.37
P63165	Small ubiquitin-related modifier 1	EBI-10299128	0.56
O14656	Torsin-1A	EBI-25847248	0.56
Interactions with other proteins (120 interactors)

Partner (UniProt)		IntAct	Confidence score
Q96KM6	Zinc finger protein 512B	EBI-7217655	0.37
Q9HAU4	E3 ubiquitin-protein ligase SMURF2 (hSMURF2) (EC 2.3.2.26) (HECT-type E3 ubiquitin transferase SMURF2) (SMAD ubiquitination regulatory factor 2) (SMAD-specific E3 ubiquitin-protein ligase 2)	EBI-7236747	0.37
P07174	Tumor necrosis factor receptor superfamily member 16 (Gp80-LNGFR) (Low affinity neurotrophin receptor p75NTR) (Low-affinity nerve growth factor receptor) (NGF receptor) (p75 ICD) (CD antigen CD271)	EBI-3650727	0.52
Q13895	Bystin	EBI-8648045	0.78
Q86YD7	Protein FAM90A1	EBI-8649669	0.37
O00308	NEDD4-like E3 ubiquitin-protein ligase WWP2 (EC 2.3.2.26) (Atrophin-1-interacting protein 2) (AIP2) (HECT-type E3 ubiquitin transferase WWP2) (WW domain-containing protein 2)	EBI-8649783	0.78
Q7L5A3	Protein FAM214B	EBI-8652593	0.74
P22681	E3 ubiquitin-protein ligase CBL (EC 2.3.2.27) (Casitas B-lineage lymphoma proto-oncogene) (Proto-oncogene c-Cbl) (RING finger protein 55) (RING-type E3 ubiquitin transferase CBL) (Signal transduction protein CBL)	EBI-4307836	0.37
Q9Y508	E3 ubiquitin-protein ligase RNF114 (EC 2.3.2.27) (RING finger protein 114) (RING-type E3 ubiquitin transferase RNF114) (Zinc finger protein 228) (Zinc finger protein 313)	EBI-4308190	0.37
Q9ULV8	E3 ubiquitin-protein ligase CBL-C (EC 2.3.2.27) (RING finger protein 57) (RING-type E3 ubiquitin transferase CBL-C) (SH3-binding protein CBL-3) (SH3-binding protein CBL-C) (Signal transduction protein CBL-C)	EBI-4308183	0.37
Q8N9I9	Probable E3 ubiquitin-protein ligase DTX3 (EC 2.3.2.27) (Protein deltex-3) (Deltex3) (RING finger protein 154) (RING-type E3 ubiquitin transferase DTX3)	EBI-4308197	0.67
Q9Y4K3	TNF receptor-associated factor 6 (EC 2.3.2.27) (E3 ubiquitin-protein ligase TRAF6) (Interleukin-1 signal transducer) (RING finger protein 85) (RING-type E3 ubiquitin transferase TRAF6)	EBI-6592571	0.27
O60341	Lysine-specific histone demethylase 1A (EC 1.14.99.66) (BRAF35-HDAC complex protein BHC110) (Flavin-containing amine oxidase domain-containing protein 2) ([histone H3]-dimethyl-L-lysine(4) FAD-dependent demethylase 1A)	EBI-8486112	0.67
Q9HCE7	E3 ubiquitin-protein ligase SMURF1 (hSMURF1) (EC 2.3.2.26) (HECT-type E3 ubiquitin transferase SMURF1) (SMAD ubiquitination regulatory factor 1) (SMAD-specific E3 ubiquitin-protein ligase 1)	EBI-9846435	0.59
A8KA13	B-cell CLL/lymphoma 6, member B (Zinc finger protein), isoform CRA_a (cDNA FLJ16548 fis, clone PLACE7000410, highly similar to B-cell CLL/lymphoma 6 member B protein) (cDNA FLJ77637) (cDNA FLJ77701, highly similar to Homo sapiens B-cell CLL/lymphoma 6, member B (zinc finger protein)(BCL6B), mRNA)	EBI-10174929	0.56
E9PJI5	Nuclear pore complex-interacting protein family member A7	EBI-10177056	0.56
Q7Z3B3	KAT8 regulatory NSL complex subunit 1 (MLL1/MLL complex subunit KANSL1) (MSL1 homolog 1) (hMSL1v1) (NSL complex protein NSL1) (Non-specific lethal 1 homolog)	EBI-10178494	0.56
P11441	Ubiquitin-like protein 4A (Ubiquitin-like protein GDX)	EBI-10197585	0.72
P17036	Zinc finger protein 3 (Zinc finger protein HF.12) (Zinc finger protein HZF3.1) (Zinc finger protein KOX25)	EBI-10199773	0.72
P29597	Non-receptor tyrosine-protein kinase TYK2 (EC 2.7.10.2)	EBI-10204906	0.56
P47897	Glutamine--tRNA ligase (EC 6.1.1.18) (Glutaminyl-tRNA synthetase) (GlnRS)	EBI-10209891	0.72
Q13084	39S ribosomal protein L28, mitochondrial (L28mt) (MRP-L28) (Melanoma antigen p15) (Melanoma-associated antigen recognized by T-lymphocytes) (Mitochondrial large ribosomal subunit protein bL28m)	EBI-10227866	0.67
Q86U76	Zinc finger protein 3 (Zinc finger protein 3 (A8-51))	EBI-10258783	0.56
Q8IX06	Putative exonuclease GOR (EC 3.1.-.-) (Antigen GOR homolog) (RNA exonuclease 1 homolog-like 1)	EBI-10262403	0.56
Q8N7F7	Ubiquitin-like protein 4B	EBI-10267521	0.78
Q8N9N5	Protein BANP (BEN domain-containing protein 1) (Btg3-associated nuclear protein) (Scaffold/matrix-associated region-1-binding protein)	EBI-16433516	0.72
Q8TBE0	Bromo adjacent homology domain-containing 1 protein (BAH domain-containing protein 1)	EBI-10273241	0.72
Q96BU6	EXOC7 protein	EBI-10282502	0.56
Q96D16	FBXL18 protein	EBI-10284444	0.56
O75052	Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein (C-terminal PDZ ligand of neuronal nitric oxide synthase protein) (Nitric oxide synthase 1 adaptor protein)	EBI-10299118	0.56
Q15323	Keratin, type I cuticular Ha1 (Hair keratin, type I Ha1) (Keratin-31) (K31)	EBI-10299152	0.72
Q6A162	Keratin, type I cytoskeletal 40 (Cytokeratin-40) (CK-40) (Keratin-40) (K40) (Type I hair keratin Ka36)	EBI-10299162	0.72
Q8IX15	Homeobox and leucine zipper protein Homez (Homeodomain leucine zipper-containing factor)	EBI-10299172	0.56
Q96EA4	Protein Spindly (hSpindly) (Arsenite-related gene 1 protein) (Coiled-coil domain-containing protein 99) (Rhabdomyosarcoma antigen MU-RMS-40.4A) (Spindle apparatus coiled-coil domain-containing protein 1)	EBI-10299184	0.56
Q9H0M0	NEDD4-like E3 ubiquitin-protein ligase WWP1 (EC 2.3.2.26) (Atrophin-1-interacting protein 5) (AIP5) (HECT-type E3 ubiquitin transferase WWP1) (TGIF-interacting ubiquitin ligase 1) (Tiul1) (WW domain-containing protein 1)	EBI-10299194	0.56
Q9Y2W2	WW domain-binding protein 11 (WBP-11) (Npw38-binding protein) (NpwBP) (SH3 domain-binding protein SNP70) (Splicing factor that interacts with PQBP-1 and PP1)	EBI-10299204	0.56
Q9H8Y8	Golgi reassembly-stacking protein 2 (GRS2) (Golgi phosphoprotein 6) (GOLPH6) (Golgi reassembly-stacking protein of 55 kDa) (GRASP55) (p59)	EBI-10309674	0.67
Q9NPH2	Inositol-3-phosphate synthase 1 (IPS 1) (EC 5.5.1.4) (Myo-inositol 1-phosphate synthase) (MI-1-P synthase) (MIP synthase) (hIPS) (Myo-inositol 1-phosphate synthase A1) (hINO1)	EBI-10311471	0.72
Q9NXW9	Alpha-ketoglutarate-dependent dioxygenase alkB homolog 4 (Alkylated DNA repair protein alkB homolog 4) (DNA N6-methyl adenine demethylase ALKBH4) (EC 1.14.11.51) (Lysine-specific demethylase ALKBH4) (EC 1.14.11.-)	EBI-10316511	0.67
Q9P0N9	TBC1 domain family member 7 (Cell migration-inducing protein 23)	EBI-10317714	0.84
Q9P0T4	Zinc finger protein 581	EBI-10318082	0.72
Q9HBZ2	Aryl hydrocarbon receptor nuclear translocator 2 (ARNT protein 2) (Class E basic helix-loop-helix protein 1) (bHLHe1)	EBI-21247403	0.37
X5D9H9	Aryl-hydrocarbon receptor nuclear translocator 2 isoform B	EBI-21247482	0.37
X5D7T2	Aryl-hydrocarbon receptor nuclear translocator 2 isoform C	EBI-21247508	0.37
X5DP31	Aryl-hydrocarbon receptor nuclear translocator 2 isoform E	EBI-21247717	0.37
P03203	Epstein-Barr nuclear antigen 4 (EBNA-4) (EBV nuclear antigen 4) (Epstein-Barr nuclear antigen 3B) (EBNA-3B) (EBV nuclear antigen 3B)	EBI-11736686	0.37
Q8AZK7	Epstein-Barr nuclear antigen leader protein (EBNA-LP) (EBV nuclear antigen leader protein) (Epstein-Barr nuclear antigen 5) (EBNA-5) (EBV nuclear antigen 5)	EBI-11736753	0.37
Q9E7P0	Genome polyprotein	EBI-11361159	0.51
Q5ERI7	Genome polyprotein	EBI-11423767	0.37
P38340	Alpha N-terminal protein methyltransferase 1 (EC 2.1.1.244) (Translation associated element 1) (X-Pro-Lys N-terminal protein methyltransferase 1) (NTM1)	EBI-11529060	0.56
A0A0S2Z4Q4	Hepatocyte growth factor-regulated tyrosine kinase substrate	EBI-16433566	0.56
O14964	Hepatocyte growth factor-regulated tyrosine kinase substrate (Hrs) (Protein pp110)	EBI-16433556	0.72
A0A0S2Z5X4	Zinc finger protein 688 isoform 4	EBI-16433576	0.56
B4DE54	Protein BANP	EBI-16433536	0.56
A0A0S2Z5G4	Protein BANP	EBI-16433546	0.56
Q08379	Golgin subfamily A member 2 (130 kDa cis-Golgi matrix protein) (GM130) (GM130 autoantigen) (Golgin-95)	EBI-11770260	0.70
Q93062	RNA-binding protein with multiple splicing (RBP-MS) (Heart and RRM expressed sequence) (Hermes)	EBI-11770604	0.49
Q15427	Splicing factor 3B subunit 4 (Pre-mRNA-splicing factor SF3b 49 kDa subunit) (Spliceosome-associated protein 49) (SAP 49)	EBI-24299939	0.56
Q9BRJ7	Tudor-interacting repair regulator protein (NUDT16-like protein 1) (Protein syndesmos)	EBI-24307467	0.56
P17980	26S proteasome regulatory subunit 6A (26S proteasome AAA-ATPase subunit RPT5) (Proteasome 26S subunit ATPase 3) (Proteasome subunit P50) (Tat-binding protein 1) (TBP-1)	EBI-24315860	0.67
Q9UHD9	Ubiquilin-2 (Chap1) (DSK2 homolog) (Protein linking IAP with cytoskeleton 2) (PLIC-2) (hPLIC-2) (Ubiquitin-like product Chap1/Dsk2)	EBI-24320612	0.56
Q8N1B4	Vacuolar protein sorting-associated protein 52 homolog (SAC2 suppressor of actin mutations 2-like protein)	EBI-24324657	0.56
P14678	Small nuclear ribonucleoprotein-associated proteins B and B' (snRNP-B) (Sm protein B/B') (Sm-B/B') (SmB/B')	EBI-24350697	0.56
Q96PV6	Leukocyte receptor cluster member 8	EBI-24362105	0.56
Q9BYV9	Transcription regulator protein BACH2 (BTB and CNC homolog 2)	EBI-25246747	0.56
Q8NCA9	Zinc finger protein 784	EBI-25250935	0.56
P09067	Homeobox protein Hox-B5 (Homeobox protein HHO.C10) (Homeobox protein Hox-2A) (Homeobox protein Hu-1)	EBI-24367595	0.56
O43559	Fibroblast growth factor receptor substrate 3 (FGFR substrate 3) (FGFR-signaling adaptor SNT2) (Suc1-associated neurotrophic factor target 2) (SNT-2)	EBI-24482005	0.56
Q9NRI5	Disrupted in schizophrenia 1 protein	EBI-24482890	0.56
P14373	Zinc finger protein RFP (EC 2.3.2.27) (RING finger protein 76) (RING-type E3 ubiquitin transferase TRIM27) (Ret finger protein) (Tripartite motif-containing protein 27)	EBI-24487594	0.56
Q63ZY3	KN motif and ankyrin repeat domain-containing protein 2 (Ankyrin repeat domain-containing protein 25) (Matrix-remodeling-associated protein 3) (SRC-1-interacting protein) (SIP) (SRC-interacting protein) (SRC1-interacting protein)	EBI-24496096	0.56
Q9NYA3	Golgin subfamily A member 6A (Golgin linked to PML) (Golgin-like protein)	EBI-24498792	0.56
Q9Y2P0	Zinc finger protein 835	EBI-24505446	0.56
Q9NSD4	Zinc finger protein 275	EBI-24519618	0.56
Q5BKX5	UPF0692 protein C19orf54	EBI-24520077	0.56
Q9H1A7	DNA-directed RNA polymerase II subunit RPB11-b2 (RNA polymerase II subunit B11-b2) (RPB11b2) (DNA-directed RNA polymerase II subunit J3)	EBI-24524992	0.56
O76013	Keratin, type I cuticular Ha6 (Hair keratin, type I Ha6) (Keratin-36) (K36)	EBI-24607634	0.56
Q92824	Proprotein convertase subtilisin/kexin type 5 (EC 3.4.21.-) (Proprotein convertase 5) (PC5) (Proprotein convertase 6) (PC6) (hPC6) (Subtilisin/kexin-like protease PC5)	EBI-24629750	0.56
Q6ZNG0	Zinc finger protein 620	EBI-23690273	0.56
P14598	Neutrophil cytosol factor 1 (NCF-1) (47 kDa autosomal chronic granulomatous disease protein) (47 kDa neutrophil oxidase factor) (NCF-47K) (Neutrophil NADPH oxidase factor 1) (Nox organizer 2) (Nox-organizing protein 2) (SH3 and PX domain-containing protein 1A) (p47-phox)	EBI-24677127	0.68
Q13360	Zinc finger protein 177	EBI-24697281	0.56
P78317	E3 ubiquitin-protein ligase RNF4 (EC 2.3.2.27) (RING finger protein 4) (Small nuclear ring finger protein) (Protein SNURF)	EBI-24552429	0.56
Q9UPG8	Zinc finger protein PLAGL2 (Pleiomorphic adenoma-like protein 2)	EBI-24792712	0.56
Q9BUH8	Brain-enriched guanylate kinase-associated protein	EBI-24795656	0.56
Q15599	Na(+)/H(+) exchange regulatory cofactor NHE-RF2 (NHERF-2) (NHE3 kinase A regulatory protein E3KARP) (SRY-interacting protein 1) (SIP-1) (Sodium-hydrogen exchanger regulatory factor 2) (Solute carrier family 9 isoform A3 regulatory factor 2) (Tyrosine kinase activator protein 1) (TKA-1)	EBI-24371576	0.56
Q86VP1	Tax1-binding protein 1 (TRAF6-binding protein)	EBI-24378843	0.56
A2BDE7	PHLDA1 protein	EBI-24379938	0.56
Q9UGI0	Ubiquitin thioesterase ZRANB1 (EC 3.4.19.12) (TRAF-binding domain-containing protein) (hTrabid) (Zinc finger Ran-binding domain-containing protein 1)	EBI-24388719	0.56
Q9BQQ3	Golgi reassembly-stacking protein 1 (Golgi peripheral membrane protein p65) (Golgi phosphoprotein 5) (GOLPH5) (Golgi reassembly-stacking protein of 65 kDa) (GRASP65)	EBI-24389146	0.56
A6NEM1	Golgin subfamily A member 6-like protein 9	EBI-24409903	0.56
P50570	Dynamin-2 (EC 3.6.5.5)	EBI-24413515	0.56
Q9HCK0	Zinc finger and BTB domain-containing protein 26 (Zinc finger protein 481) (Zinc finger protein Bioref)	EBI-25262184	0.56
Q8TBB1	E3 ubiquitin-protein ligase LNX (EC 2.3.2.27) (Ligand of Numb-protein X 1) (Numb-binding protein 1) (PDZ domain-containing RING finger protein 2) (RING-type E3 ubiquitin transferase LNX)	EBI-24417705	0.56
Q9P2A4	ABI gene family member 3 (New molecule including SH3) (Nesh)	EBI-24425516	0.56
Q3SY00	Testis-specific protein 10-interacting protein (Tsga10-interacting protein)	EBI-24433861	0.56
Q05516	Zinc finger and BTB domain-containing protein 16 (Promyelocytic leukemia zinc finger protein) (Zinc finger protein 145) (Zinc finger protein PLZF)	EBI-24450519	0.56
Q01664	Transcription factor AP-4 (Activating enhancer-binding protein 4) (Class C basic helix-loop-helix protein 41) (bHLHc41)	EBI-24457966	0.56
Q9UBP5	Hairy/enhancer-of-split related with YRPW motif protein 2 (Cardiovascular helix-loop-helix factor 1) (hCHF1) (Class B basic helix-loop-helix protein 32) (bHLHb32) (HES-related repressor protein 2) (Hairy and enhancer of split-related protein 2) (HESR-2) (Hairy-related transcription factor 2) (HRT-2) (hHRT2) (Protein gridlock homolog)	EBI-24467380	0.56
Q6P2H3	Centrosomal protein of 85 kDa (Cep85) (Coiled-coil domain-containing protein 21)	EBI-24551937	0.56
O00167	Eyes absent homolog 2 (EC 3.1.3.48)	EBI-24553247	0.56
Q6IQ23	Pleckstrin homology domain-containing family A member 7 (PH domain-containing family A member 7)	EBI-24564131	0.56
Q86X51	EZH inhibitory protein	EBI-24585078	0.56
Q9Y4B4	Helicase ARIP4 (EC 3.6.4.12) (Androgen receptor-interacting protein 4) (RAD54-like protein 2)	EBI-24590443	0.56
Q9C0D7	Probable ribonuclease ZC3H12C (EC 3.1.-.-) (MCP-induced protein 3) (Zinc finger CCCH domain-containing protein 12C)	EBI-24597046	0.56
P52435	DNA-directed RNA polymerase II subunit RPB11-a (RNA polymerase II subunit B11-a) (RPB11a) (DNA-directed RNA polymerase II subunit J-1) (RNA polymerase II 13.3 kDa subunit)	EBI-24598724	0.56
Q9NP66	High mobility group protein 20A (HMG box-containing protein 20A) (HMG domain-containing protein 1) (HMG domain-containing protein HMGX1)	EBI-24652703	0.56
Q7KZS0	Ubiquitin-conjugating enzyme E2I (UBC9 homolog, yeast) (Ubiquitin-conjugating enzyme E2I (UBC9 homolog, yeast), isoform CRA_b)	EBI-24746458	0.56
Q9UJ78	Zinc finger MYM-type protein 5 (Zinc finger protein 198-like 1) (Zinc finger protein 237)	EBI-25204841	0.56
A0A0U1RQF7	DPEP2 neighbor protein	EBI-25267249	0.56
P49639	Homeobox protein Hox-A1 (Homeobox protein Hox-1F)	EBI-25267383	0.56
Q7RTX7	Cation channel sperm-associated protein 4 (CatSper4)	EBI-21541280	0.35
Q96PC5	Melanoma inhibitory activity protein 2 (MIA protein 2) (CTAGE family member 5 ER export factor) (Cutaneous T-cell lymphoma-associated antigen 5) (Meningioma-expressed antigen 6/11)	EBI-21567144	0.35
P50914	60S ribosomal protein L14 (CAG-ISL 7) (Large ribosomal subunit protein eL14)	EBI-21741266	0.35
Q92844	TRAF family member-associated NF-kappa-B activator (TRAF-interacting protein) (I-TRAF)	EBI-20737201	0.35
O43294	Transforming growth factor beta-1-induced transcript 1 protein (Androgen receptor coactivator 55 kDa protein) (Androgen receptor-associated protein of 55 kDa) (Hydrogen peroxide-inducible clone 5 protein) (Hic-5)	EBI-21979966	0.60
Q8N4T4	Rho guanine nucleotide exchange factor 39	EBI-25408280	0.35
Q8IZD9	Dedicator of cytokinesis protein 3 (Modifier of cell adhesion) (Presenilin-binding protein) (PBP)	EBI-25411696	0.35
O14773	Tripeptidyl-peptidase 1 (TPP-1) (EC 3.4.14.9) (Cell growth-inhibiting gene 1 protein) (Lysosomal pepstatin-insensitive protease) (LPIC) (Tripeptidyl aminopeptidase) (Tripeptidyl-peptidase I) (TPP-I)	EBI-25838614	0.56
P22314	Ubiquitin-like modifier-activating enzyme 1 (EC 6.2.1.45) (Protein A1S9) (Ubiquitin-activating enzyme E1)	EBI-25894497	0.56
Q8N187	Calcium-responsive transcription factor (Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 8 protein) (Calcium-response factor) (CaRF) (Testis development protein NYD-SP24)	EBI-25929046	0.56

Cross-References

Database	Links
UNIPROT	Q9BUZ4 O75615 Q14848 Q2KJU4 Q2PJN8
PDB	2EOD 2YUC 3ZJB 4K8U 4M4E 5YC1
Pfam	PF00097 PF02176
PROSITE	PS50144 PS00518 PS50089 PS50145
OMIM	602464
DisGeNET	9618

TNF receptor-associated factor 4 (Homo sapiens)

General Information

Protein Information

Structure Viewer (PDB: 3ZJB)

Subcellular Location

Description Show

Position in the Nuclear Envelope

Membrane Topology

Assigned Ontology terms

Biology & Function

Description Hide

Assigned Ontology terms

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (7 interactors)

Interactions with other proteins (120 interactors)

Cross-References

Database

Links

Description

Description