Protein Information |
|
|---|---|
| Protein Name | Cyclin-dependent kinase 19 |
| Accession Code | Q9BWU1 |
| Gene | CDK19 |
| Organism | Homo sapiens | Human (Taxonomy: 9606) |
| Part of Reference Proteome? | Yes |
| Sequence (Length: 502) | |
|
MDYDFKAKLAAERERVEDLFEYEGCKVGRGTYGHVYKARRKDGKDEKEYALKQIEGTGISMSACREIALLRELKHPNVIALQKVFLSHSDRKVWLLFDYAEHDLWHIIKFHRASKANKKPMQLPRSMVKS LLYQILDGIHYLHANWVLHRDLKPANILVMGEGPERGRVKIADMGFARLFNSPLKPLADLDPVVVTFWYRAPELLLGARHYTKAIDIWAIGCIFAELLTSEPIFHCRQEDIKTSNPFHHDQLDRIFSVMG FPADKDWEDIRKMPEYPTLQKDFRRTTYANSSLIKYMEKHKVKPDSKVFLLLQKLLTMDPTKRITSEQALQDPYFQEDPLPTLDVFAGCQIPYPKREFLNEDDPEEKGDKNQQQQQNQHQQPTAPPQQAA APPQAPPPQQNSTQTNGTAGGAGAGVGGTGAGLQHSQDSSLNQVPPNKKPRLGPSGANSGGPVMPSDYQHSSSRLNYQSSVQGSSQSQSTLGYSSSSQQSSQYHPSHQAHRY |
|
Description |
||
|---|---|---|
| Cytoplasm {Experimental EvidencePubMed:32330417}. Cytoplasm, perinuclear region {Experimental EvidencePubMed:32330417}. Nucleus {Experimental EvidencePubMed:32330417}. | Position in the Nuclear Envelope |
|
| Location | Location ID | Description |
| Perinuclear Region | SL-0198 | The perinuclear region is the cytoplasmic region just around the nucleus. | Membrane Topology |
| Topology | Source | Annotation Type |
| Unknown | UniProt | Sequence Analysis | Assigned Ontology terms |
| Cellular Component | Cytosol (GO:0005829) Mediator Complex (GO:0016592) Nucleoplasm (GO:0005654) Nucleus (GO:0005634) Perinuclear Region Of Cytoplasm (GO:0048471) |
|
Description |
|
|---|---|
Assigned Ontology terms |
|
| Biological Process | Cellular Response To Lipopolysaccharide (GO:0071222) Positive Regulation Of Apoptotic Process (GO:0043065) Positive Regulation Of Inflammatory Response (GO:0050729) Protein Phosphorylation (GO:0006468) |
| Molecular Function | ATP Binding (GO:0005524) Cyclin-Dependent Protein Serine/Threonine Kinase Activity (GO:0004693) Protein Serine Kinase Activity (GO:0106310) RNA Polymerase II CTD Heptapeptide Repeat Kinase Activity (GO:0008353) |
Description |
|
|---|---|
| Developmental and epileptic encephalopathy 87 (DEE87) [MIM:618916]: A form of epileptic encephalopathy, a heterogeneous group of severe early-onset epilepsies characterized by refractory seizures, neurodevelopmental impairment, and poor prognosis. Development is normal prior to seizure onset, after which cognitive and motor delays become apparent. DEE87 inheritance is autosomal dominant. {Experimental EvidencePubMed:32330417, Experimental EvidencePubMed:33134521, Experimental EvidencePubMed:33495529}. Note=The disease is caused by variants affecting the gene represented in this entry. | Database Associations |
| OMIM | 614720 618916 |
| DisGeNET | 23097 |
Interactions with Nuclear Envelope proteins (2 interactors) |
|||
|---|---|---|---|
| Partner (NucEnvDB) | IntAct | Confidence score | |
| P10909 | Clusterin alpha chain | EBI-6381327 | 0.35 |
| P50613 | Cyclin-dependent kinase 7 | EBI-15560892 | 0.44 | Interactions with other proteins (52 interactors) |
| Partner (UniProt) | IntAct | Confidence score | |
| A0JLT2 | Mediator of RNA polymerase II transcription subunit 19 (Lung cancer metastasis-related protein 1) (Mediator complex subunit 19) | EBI-394580 | 0.62 |
| Q9BTT4 | Mediator of RNA polymerase II transcription subunit 10 (Mediator complex subunit 10) (Transformation-related gene 17 protein) (TRG-17) (Transformation-related gene 20 protein) (TRG-20) | EBI-394793 | 0.62 |
| Q9NWA0 | Mediator of RNA polymerase II transcription subunit 9 (Mediator complex subunit 9) | EBI-394834 | 0.71 |
| Q9NX70 | Mediator of RNA polymerase II transcription subunit 29 (Intersex-like protein) (Mediator complex subunit 29) | EBI-394875 | 0.71 |
| Q920D3 | Mediator of RNA polymerase II transcription subunit 28 (Mediator complex subunit 28) | EBI-394916 | 0.35 |
| O95402 | Mediator of RNA polymerase II transcription subunit 26 (Activator-recruited cofactor 70 kDa component) (ARC70) (Cofactor required for Sp1 transcriptional activation subunit 7) (CRSP complex subunit 7) (Mediator complex subunit 26) (Transcriptional coactivator CRSP70) | EBI-394957 | 0.71 |
| P49336 | Cyclin-dependent kinase 8 (EC 2.7.11.22) (EC 2.7.11.23) (Cell division protein kinase 8) (Mediator complex subunit CDK8) (Mediator of RNA polymerase II transcription subunit CDK8) (Protein kinase K35) | EBI-395095 | 0.40 |
| Q71F56 | Mediator of RNA polymerase II transcription subunit 13-like (Mediator complex subunit 13-like) (Thyroid hormone receptor-associated protein 2) (Thyroid hormone receptor-associated protein complex 240 kDa component-like) | EBI-395095 | 0.67 |
| Q9P086 | Mediator of RNA polymerase II transcription subunit 11 (Mediator complex subunit 11) | EBI-395095 | 0.56 |
| Q93074 | Mediator of RNA polymerase II transcription subunit 12 (Activator-recruited cofactor 240 kDa component) (ARC240) (CAG repeat protein 45) (Mediator complex subunit 12) (OPA-containing protein) (Thyroid hormone receptor-associated protein complex 230 kDa component) (Trap230) (Trinucleotide repeat-containing gene 11 protein) | EBI-395095 | 0.85 |
| Q9UHV7 | Mediator of RNA polymerase II transcription subunit 13 (Activator-recruited cofactor 250 kDa component) (ARC250) (Mediator complex subunit 13) (Thyroid hormone receptor-associated protein 1) (Thyroid hormone receptor-associated protein complex 240 kDa component) (Trap240) (Vitamin D3 receptor-interacting protein complex component DRIP250) (DRIP250) | EBI-395095 | 0.74 |
| O60244 | Mediator of RNA polymerase II transcription subunit 14 (Activator-recruited cofactor 150 kDa component) (ARC150) (Cofactor required for Sp1 transcriptional activation subunit 2) (CRSP complex subunit 2) (Mediator complex subunit 14) (RGR1 homolog) (hRGR1) (Thyroid hormone receptor-associated protein complex 170 kDa component) (Trap170) (Transcriptional coactivator CRSP150) (Vitamin D3 receptor-interacting protein complex 150 kDa component) (DRIP150) | EBI-395095 | 0.67 |
| Q96RN5 | Mediator of RNA polymerase II transcription subunit 15 (Activator-recruited cofactor 105 kDa component) (ARC105) (CTG repeat protein 7a) (Mediator complex subunit 15) (Positive cofactor 2 glutamine/Q-rich-associated protein) (PC2 glutamine/Q-rich-associated protein) (TPA-inducible gene 1 protein) (TIG-1) (Trinucleotide repeat-containing gene 7 protein) | EBI-395095 | 0.67 |
| Q9Y2X0 | Mediator of RNA polymerase II transcription subunit 16 (Mediator complex subunit 16) (Thyroid hormone receptor-associated protein 5) (Thyroid hormone receptor-associated protein complex 95 kDa component) (Trap95) (Vitamin D3 receptor-interacting protein complex 92 kDa component) (DRIP92) | EBI-395095 | 0.67 |
| Q9NVC6 | Mediator of RNA polymerase II transcription subunit 17 (Activator-recruited cofactor 77 kDa component) (ARC77) (Cofactor required for Sp1 transcriptional activation subunit 6) (CRSP complex subunit 6) (Mediator complex subunit 17) (Thyroid hormone receptor-associated protein complex 80 kDa component) (Trap80) (Transcriptional coactivator CRSP77) (Vitamin D3 receptor-interacting protein complex 80 kDa component) (DRIP80) | EBI-395095 | 0.67 |
| Q9BUE0 | Mediator of RNA polymerase II transcription subunit 18 (Mediator complex subunit 18) (p28b) | EBI-395095 | 0.56 |
| Q15648 | Mediator of RNA polymerase II transcription subunit 1 (Activator-recruited cofactor 205 kDa component) (ARC205) (Mediator complex subunit 1) (Peroxisome proliferator-activated receptor-binding protein) (PBP) (PPAR-binding protein) (Thyroid hormone receptor-associated protein complex 220 kDa component) (Trap220) (Thyroid receptor-interacting protein 2) (TR-interacting protein 2) (TRIP-2) (Vitamin D receptor-interacting protein complex component DRIP205) (p53 regulatory protein RB18A) | EBI-395095 | 0.67 |
| Q9H944 | Mediator of RNA polymerase II transcription subunit 20 (Mediator complex subunit 20) (TRF-proximal protein homolog) (hTRFP) | EBI-395095 | 0.67 |
| Q13503 | Mediator of RNA polymerase II transcription subunit 21 (Mediator complex subunit 21) (RNA polymerase II holoenzyme component SRB7) (RNAPII complex component SRB7) (hSrb7) | EBI-395095 | 0.67 |
| Q15528 | Mediator of RNA polymerase II transcription subunit 22 (Mediator complex subunit 22) (Surfeit locus protein 5) (Surf-5) | EBI-395095 | 0.67 |
| Q9ULK4 | Mediator of RNA polymerase II transcription subunit 23 (Activator-recruited cofactor 130 kDa component) (ARC130) (Cofactor required for Sp1 transcriptional activation subunit 3) (CRSP complex subunit 3) (Mediator complex subunit 23) (Protein sur-2 homolog) (hSur-2) (Transcriptional coactivator CRSP130) (Vitamin D3 receptor-interacting protein complex 130 kDa component) (DRIP130) | EBI-395095 | 0.67 |
| O75448 | Mediator of RNA polymerase II transcription subunit 24 (Activator-recruited cofactor 100 kDa component) (ARC100) (Cofactor required for Sp1 transcriptional activation subunit 4) (CRSP complex subunit 4) (Mediator complex subunit 24) (Thyroid hormone receptor-associated protein 4) (Thyroid hormone receptor-associated protein complex 100 kDa component) (Trap100) (hTRAP100) (Vitamin D3 receptor-interacting protein complex 100 kDa component) (DRIP100) | EBI-395095 | 0.67 |
| Q6P2C8 | Mediator of RNA polymerase II transcription subunit 27 (Cofactor required for Sp1 transcriptional activation subunit 8) (CRSP complex subunit 8) (Mediator complex subunit 27) (P37 TRAP/SMCC/PC2 subunit) (Transcriptional coactivator CRSP34) | EBI-395095 | 0.67 |
| Q9H204 | Mediator of RNA polymerase II transcription subunit 28 (Endothelial-derived protein 1) (Mediator complex subunit 28) (Merlin and Grb2-interacting cytoskeletal protein) (Magicin) (Tumor angiogenesis marker EG-1) | EBI-395095 | 0.56 |
| Q96HR3 | Mediator of RNA polymerase II transcription subunit 30 (Mediator complex subunit 30) (TRAP/Mediator complex component TRAP25) (Thyroid hormone receptor-associated protein 6) (Thyroid hormone receptor-associated protein complex 25 kDa component) (Trap25) | EBI-395095 | 0.67 |
| Q9Y3C7 | Mediator of RNA polymerase II transcription subunit 31 (Mediator complex subunit 31) (Mediator complex subunit SOH1) (hSOH1) | EBI-395095 | 0.74 |
| Q9NPJ6 | Mediator of RNA polymerase II transcription subunit 4 (Activator-recruited cofactor 36 kDa component) (ARC36) (Mediator complex subunit 4) (TRAP/SMCC/PC2 subunit p36 subunit) (Vitamin D3 receptor-interacting protein complex 36 kDa component) (DRIP36) | EBI-395095 | 0.67 |
| O75586 | Mediator of RNA polymerase II transcription subunit 6 (Activator-recruited cofactor 33 kDa component) (ARC33) (Mediator complex subunit 6) (hMed6) (Renal carcinoma antigen NY-REN-28) | EBI-395095 | 0.67 |
| O43513 | Mediator of RNA polymerase II transcription subunit 7 (hMED7) (Activator-recruited cofactor 34 kDa component) (ARC34) (Cofactor required for Sp1 transcriptional activation subunit 9) (CRSP complex subunit 9) (Mediator complex subunit 7) (RNA polymerase transcriptional regulation mediator subunit 7 homolog) (Transcriptional coactivator CRSP33) | EBI-395095 | 0.74 |
| Q96G25 | Mediator of RNA polymerase II transcription subunit 8 (Activator-recruited cofactor 32 kDa component) (ARC32) (Mediator complex subunit 8) | EBI-395095 | 0.67 |
| Q8TDY2 | RB1-inducible coiled-coil protein 1 (FAK family kinase-interacting protein of 200 kDa) (FIP200) | EBI-1068461 | 0.00 |
| Q8TBZ2 | MYCBP-associated protein (AMAM-1) (AMY-1-binding protein 1) (AMAP-1) | EBI-1074027 | 0.00 |
| P0DOE9 | Non-structural protein 1 (NS1) (Non-structural protein 1C) | EBI-6138583 | 0.35 |
| P05090 | Apolipoprotein D (Apo-D) (ApoD) | EBI-6381327 | 0.35 |
| P12273 | Prolactin-inducible protein (Gross cystic disease fluid protein 15) (GCDFP-15) (Prolactin-induced protein) (Secretory actin-binding protein) (SABP) (gp17) | EBI-6381327 | 0.35 |
| P25311 | Zinc-alpha-2-glycoprotein (Zn-alpha-2-GP) (Zn-alpha-2-glycoprotein) | EBI-6381327 | 0.35 |
| Q8IUD2 | ELKS/Rab6-interacting/CAST family member 1 (ERC-1) (Rab6-interacting protein 2) | EBI-6381327 | 0.53 |
| P24863 | Cyclin-C (SRB11 homolog) (hSRB11) | EBI-6381327 | 0.80 |
| P50750 | Cyclin-dependent kinase 9 (EC 2.7.11.22) (EC 2.7.11.23) (C-2K) (Cell division cycle 2-like protein kinase 4) (Cell division protein kinase 9) (Serine/threonine-protein kinase PITALRE) (Tat-associated kinase complex catalytic subunit) | EBI-8765229 | 0.35 |
| Q12888 | TP53-binding protein 1 (53BP1) (p53-binding protein 1) (p53BP1) | EBI-20207896 | 0.27 |
| Q83B01 | Ankyrin repeats (3 copies) | EBI-21286333 | 0.37 |
| Q96DY7 | Mdm2-binding protein (hMTBP) | EBI-28945018 | 0.35 |
| Q8ND56 | Protein LSM14 homolog A (Protein FAM61A) (Protein SCD6 homolog) (Putative alpha-synuclein-binding protein) (AlphaSNBP) (RNA-associated protein 55A) (hRAP55) (hRAP55A) | EBI-28945018 | 0.35 |
| Q86YW9 | Mediator of RNA polymerase II transcription subunit 12-like protein (Mediator complex subunit 12-like protein) (Thyroid hormone receptor-associated-like protein) (Trinucleotide repeat-containing gene 11 protein-like) | EBI-28945018 | 0.35 |
| Q71SY5 | Mediator of RNA polymerase II transcription subunit 25 (Activator interaction domain-containing protein 1) (Activator-recruited cofactor 92 kDa component) (ARC92) (Mediator complex subunit 25) (p78) | EBI-28945018 | 0.35 |
| Q16543 | Hsp90 co-chaperone Cdc37 (Hsp90 chaperone protein kinase-targeting subunit) (p50Cdc37) [Cleaved into: Hsp90 co-chaperone Cdc37, N-terminally processed] | EBI-28945018 | 0.35 |
| Q15021 | Condensin complex subunit 1 (Chromosome condensation-related SMC-associated protein 1) (Chromosome-associated protein D2) (hCAP-D2) (Non-SMC condensin I complex subunit D2) (XCAP-D2 homolog) | EBI-28945018 | 0.35 |
| P49736 | DNA replication licensing factor MCM2 (EC 3.6.4.12) (Minichromosome maintenance protein 2 homolog) (Nuclear protein BM28) | EBI-28945018 | 0.35 |
| P45983 | Mitogen-activated protein kinase 8 (MAP kinase 8) (MAPK 8) (EC 2.7.11.24) (JNK-46) (Stress-activated protein kinase 1c) (SAPK1c) (Stress-activated protein kinase JNK1) (c-Jun N-terminal kinase 1) | EBI-28945018 | 0.35 |
| P33991 | DNA replication licensing factor MCM4 (EC 3.6.4.12) (CDC21 homolog) (P1-CDC21) | EBI-28945018 | 0.35 |
| P25205 | DNA replication licensing factor MCM3 (EC 3.6.4.12) (DNA polymerase alpha holoenzyme-associated protein P1) (P1-MCM3) (RLF subunit beta) (p102) | EBI-28945018 | 0.35 |
| Q99816 | Tumor susceptibility gene 101 protein (ESCRT-I complex subunit TSG101) | EBI-30840175 | 0.44 |
Database | Links |
| UNIPROT | Q9BWU1 Q5JQZ7 Q5JR00 Q8TC78 Q9UPX2 |
| Pfam | PF00069 |
| PROSITE | PS00107 PS50011 PS00108 |
| OMIM | 614720 618916 |
| DisGeNET | 23097 |
National and Kapodistrian University of Athens
Department of Biology
Biophysics & Bioinformatics Laboratory