Protein Information |
|
|---|---|
| Protein Name | Clusterin alpha chain |
| Accession Code | P10909 |
| Gene | CLU |
| Organism | Homo sapiens | Human (Taxonomy: 9606) |
| Part of Reference Proteome? | Yes |
| Sequence (Length: 449) | |
|
MMKTLLLFVGLLLTWESGQVLGDQTVSDNELQEMSNQGSKYVNKEIQNAVNGVKQIKTLIEKTNEERKTLLSNLEEAKKKKEDALNETRESETKLKELPGVCNETMMALWEECKPCLKQTCMKFYARVCR SGSGLVGRQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQTHMLDVMQDHFSRASSIIDELFQDRFFTREPQDTYHYLPFSLPHRRPHFFFPKSRIVRSLMPFSPYEPLNFHAMFQPFLEMIHEAQQAMDI HFHSPAFQHPPTEFIREGDDDRTVCREIRHNSTGCLRMKDQCDKCREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLRVTTVA SHTSDSDVPSGVTEVVVKLFDSDPITVTVPVEVSRKNPKFMETVAEKALQEYRKKHREE |
|
Description |
||
|---|---|---|
| [Isoform 1]: Secreted {Experimental EvidencePubMed:11123922, Experimental EvidencePubMed:17260971, Experimental EvidencePubMed:17412999, Experimental EvidencePubMed:17451556, Experimental EvidencePubMed:2387851, Experimental EvidencePubMed:24073260, Experimental EvidencePubMed:2780565, Experimental EvidencePubMed:3154963, Experimental EvidencePubMed:8292612, Experimental EvidencePubMed:8328966}. Note=Can retrotranslocate from the secretory compartments to the cytosol upon cellular stress. {Experimental EvidencePubMed:17451556}. [Isoform 4]: Cytoplasm {Experimental EvidencePubMed:24073260}. Note=Keeps cytoplasmic localization in stressed and unstressed cell. {Experimental EvidencePubMed:24073260}. [Isoform 6]: Cytoplasm {Experimental EvidencePubMed:24073260}. Note=Keeps cytoplasmic localization in stressed and unstressed cell. {Experimental EvidencePubMed:24073260}. Nucleus {Experimental EvidencePubMed:12551933, Experimental EvidencePubMed:19137541}. Cytoplasm {Experimental EvidencePubMed:12551933, ECO:0000269|PubMed:17689225, Experimental EvidencePubMed:19137541, ECO:0000269|PubMed:20068069, ECO:0000269|PubMed:22689054, Experimental EvidencePubMed:24073260}. Mitochondrion membrane; Peripheral membrane protein; Cytoplasmic side {ECO:0000269|PubMed:17689225}. Cytoplasm, cytosol {Experimental EvidencePubMed:17451556, ECO:0000269|PubMed:22689054, Experimental EvidencePubMed:24073260}. Microsome {ECO:0000269|PubMed:22689054}. Endoplasmic reticulum {ECO:0000269|PubMed:16113678, ECO:0000269|PubMed:22689054}. Mitochondrion {ECO:0000269|PubMed:16113678, ECO:0000269|PubMed:22689054}. Mitochondrion membrane {ECO:0000269|PubMed:16113678, ECO:0000269|PubMed:17689225}. Cytoplasm, perinuclear region {ECO:0000250|UniProtKB:P05371}. Cytoplasmic vesicle, secretory vesicle, chromaffin granule {ECO:0000250}. Note=Secreted isoforms can retrotranslocate from the secretory compartments to the cytosol upon cellular stress (PubMed:17451556). Detected in perinuclear foci that may be aggresomes containing misfolded, ubiquitinated proteins (PubMed:20068069). Detected at the mitochondrion membrane upon induction of apoptosis (PubMed:17689225). Under ER stress, a immaturely glycosylated pre-secreted form retrotranslocates from the endoplasmic reticulum (ER)-Golgi network to the cytoplasm to localize in the mitochondria through HSPA5 interaction (PubMed:22689054). ER stress reduces secretion (PubMed:22689054). Under the stress, minor amounts of non-secreted forms accumulate in cytoplasm (PubMed:24073260, PubMed:22689054, PubMed:17451556). Non-secreted forms emerge mainly from failed translocation, alternative splicing or non-canonical initiation start codon (PubMed:24073260, PubMed:12551933). {Experimental EvidencePubMed:12551933, Experimental EvidencePubMed:17451556, ECO:0000269|PubMed:17689225, ECO:0000269|PubMed:20068069, ECO:0000269|PubMed:22689054, Experimental EvidencePubMed:24073260}. | Position in the Nuclear Envelope |
|
| Location | Location ID | Description |
| Perinuclear Region | SL-0198 | The perinuclear region is the cytoplasmic region just around the nucleus. | Membrane Topology |
| Topology | Source | Annotation Type |
| Peripheral | UniProt | Sequence Analysis | Assigned Ontology terms |
| Cellular Component | Apical Dendrite (GO:0097440) Blood Microparticle (GO:0072562) Cell Surface (GO:0009986) Chromaffin Granule (GO:0042583) Collagen-Containing Extracellular Matrix (GO:0062023) Cytoplasm (GO:0005737) Cytosol (GO:0005829) Extracellular Exosome (GO:0070062) Extracellular Region (GO:0005576) Extracellular Space (GO:0005615) Golgi Apparatus (GO:0005794) Intracellular Membrane-Bounded Organelle (GO:0043231) Mitochondrial Inner Membrane (GO:0005743) Mitochondrion (GO:0005739) Neurofibrillary Tangle (GO:0097418) Nucleus (GO:0005634) Perinuclear Endoplasmic Reticulum Lumen (GO:0099020) Perinuclear Region Of Cytoplasm (GO:0048471) Platelet Alpha Granule Lumen (GO:0031093) Protein-Containing Complex (GO:0032991) Spherical High-Density Lipoprotein Particle (GO:0034366) Synapse (GO:0045202) |
|
Interactions with Nuclear Envelope proteins (12 interactors) |
|||
|---|---|---|---|
| Partner (NucEnvDB) | IntAct | Confidence score | |
| O14656 | Torsin-1A | EBI-21693789 | 0.35 |
| Q96HP0 | Dedicator of cytokinesis protein 6 | EBI-11117520 | 0.35 |
| Q6P9B9 | Integrator complex subunit 5 | EBI-21693789 | 0.35 |
| P62879 | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 | EBI-21693789 | 0.35 |
| Q96QG7 | Myotubularin-related protein 9 | EBI-21831285 | 0.35 |
| Q06787 | Fragile X messenger ribonucleoprotein 1 | EBI-21371844 | 0.00 |
| P10909 | Self | EBI-21371813 | 0.00 |
| Q9Z0X1 | Apoptosis-inducing factor 1, mitochondrial | EBI-11065573 | 0.35 |
| Q07817 | Bcl-2-like protein 1 | EBI-4322676 | 0.61 |
| Q9Y6D5 | Brefeldin A-inhibited guanine nucleotide-exchange protein 2 | EBI-21370252 | 0.00 |
| Q9BWU1 | Cyclin-dependent kinase 19 | EBI-6381327 | 0.35 |
| Q9DB34 | Charged multivesicular body protein 2a | EBI-11115096 | 0.35 | Interactions with other proteins (155 interactors) |
| Partner (UniProt) | IntAct | Confidence score | |
| Q9NRI5 | Disrupted in schizophrenia 1 protein | EBI-1105564 | 0.00 |
| Q9UKE5 | TRAF2 and NCK-interacting protein kinase (EC 2.7.11.1) | EBI-1105584 | 0.00 |
| P30101 | Protein disulfide-isomerase A3 (EC 5.3.4.1) (58 kDa glucose-regulated protein) (58 kDa microsomal protein) (p58) (Disulfide isomerase ER-60) (Endoplasmic reticulum resident protein 57) (ER protein 57) (ERp57) (Endoplasmic reticulum resident protein 60) (ER protein 60) (ERp60) | EBI-7172377 | 0.59 |
| P02647 | Apolipoprotein A-I (Apo-AI) (ApoA-I) (Apolipoprotein A1) [Cleaved into: Proapolipoprotein A-I (ProapoA-I); Truncated apolipoprotein A-I (Apolipoprotein A-I(1-242))] | EBI-1220621 | 0.35 |
| P01876 | Immunoglobulin heavy constant alpha 1 (Ig alpha-1 chain C region) (Ig alpha-1 chain C region BUR) (Ig alpha-1 chain C region TRO) | EBI-1221175 | 0.35 |
| P01857 | Immunoglobulin heavy constant gamma 1 (Ig gamma-1 chain C region) (Ig gamma-1 chain C region EU) (Ig gamma-1 chain C region KOL) (Ig gamma-1 chain C region NIE) | EBI-1222317 | 0.35 |
| P62993 | Growth factor receptor-bound protein 2 (Adapter protein GRB2) (Protein Ash) (SH2/SH3 adapter GRB2) | EBI-2115936 | 0.00 |
| O35638 | Cohesin subunit SA-2 (SCC3 homolog 2) (Stromal antigen 2) | EBI-2559549 | 0.40 |
| P16104 | Histone H2AX (H2a/x) (Histone H2A.X) | EBI-2564373 | 0.35 |
| P22736 | Nuclear receptor subfamily 4 group A member 1 (Early response protein NAK1) (Nuclear hormone receptor NUR/77) (Nur77) (Orphan nuclear receptor HMR) (Orphan nuclear receptor TR3) (ST-59) (Testicular receptor 3) | EBI-2681480 | 0.00 |
| P01100 | Protein c-Fos (Cellular oncogene fos) (Fos proto-oncogene, AP-1 transcription factor subunit) (G0/G1 switch regulatory protein 7) (Proto-oncogene c-Fos) (Transcription factor AP-1 subunit c-Fos) | EBI-2694247 | 0.52 |
| Q00987 | E3 ubiquitin-protein ligase Mdm2 (EC 2.3.2.27) (Double minute 2 protein) (Hdm2) (Oncoprotein Mdm2) (RING-type E3 ubiquitin transferase Mdm2) (p53-binding protein Mdm2) | EBI-2682977 | 0.00 |
| P04150 | Glucocorticoid receptor (GR) (Nuclear receptor subfamily 3 group C member 1) | EBI-2684198 | 0.00 |
| P37231 | Peroxisome proliferator-activated receptor gamma (PPAR-gamma) (Nuclear receptor subfamily 1 group C member 3) | EBI-2793955 | 0.52 |
| P17028 | Zinc finger protein 24 (Retinoic acid suppression protein A) (RSG-A) (Zinc finger and SCAN domain-containing protein 3) (Zinc finger protein 191) (Zinc finger protein KOX17) | EBI-2691450 | 0.00 |
| A0A6L7HEE9 | RNA polymerase sigma factor SigA | EBI-2836046 | 0.00 |
| P02866 | Concanavalin-A (Con A) | EBI-2906001 | 0.35 |
| O15160 | DNA-directed RNA polymerases I and III subunit RPAC1 (DNA-directed RNA polymerase I subunit C) (RNA polymerases I and III subunit AC1) (AC40) (DNA-directed RNA polymerases I and III 40 kDa polypeptide) (RPA40) (RPA39) (RPC40) | EBI-3907424 | 0.37 |
| P05181 | Cytochrome P450 2E1 (EC 1.14.14.1) (4-nitrophenol 2-hydroxylase) (EC 1.14.13.n7) (CYPIIE1) (Cytochrome P450-J) | EBI-3907394 | 0.37 |
| Q99708 | DNA endonuclease RBBP8 (EC 3.1.-.-) (CtBP-interacting protein) (CtIP) (Retinoblastoma-binding protein 8) (RBBP-8) (Retinoblastoma-interacting protein and myosin-like) (RIM) (Sporulation in the absence of SPO11 protein 2 homolog) (SAE2) | EBI-3907404 | 0.37 |
| O14901 | Krueppel-like factor 11 (Transforming growth factor-beta-inducible early growth response protein 2) (TGFB-inducible early growth response protein 2) (TIEG-2) | EBI-3907414 | 0.37 |
| Q14145 | Kelch-like ECH-associated protein 1 (Cytosolic inhibitor of Nrf2) (INrf2) (Kelch-like protein 19) | EBI-3907434 | 0.37 |
| Q9Y3Q8 | TSC22 domain family protein 4 (TSC22-related-inducible leucine zipper protein 2) (Tsc-22-like protein THG-1) | EBI-3916122 | 0.37 |
| P45984 | Mitogen-activated protein kinase 9 (MAP kinase 9) (MAPK 9) (EC 2.7.11.24) (JNK-55) (Stress-activated protein kinase 1a) (SAPK1a) (Stress-activated protein kinase JNK2) (c-Jun N-terminal kinase 2) | EBI-3927894 | 0.37 |
| P62829 | 60S ribosomal protein L23 (60S ribosomal protein L17) (Large ribosomal subunit protein uL14) | EBI-3927914 | 0.37 |
| P46379 | Large proline-rich protein BAG6 (BAG family molecular chaperone regulator 6) (BCL2-associated athanogene 6) (BAG-6) (HLA-B-associated transcript 3) (Protein G3) (Protein Scythe) | EBI-3927904 | 0.37 |
| P18509 | Pituitary adenylate cyclase-activating polypeptide (PACAP) [Cleaved into: PACAP-related peptide (PRP-48); Pituitary adenylate cyclase-activating polypeptide 27 (PACAP-27) (PACAP27); Pituitary adenylate cyclase-activating polypeptide 38 (PACAP-38) (PACAP38)] | EBI-10129061 | 0.54 |
| P06460 | Probable protein E5A | EBI-11723082 | 0.35 |
| P06792 | Probable protein E5 | EBI-11724527 | 0.35 |
| P0C739 | Protein BNLF2a | EBI-11725101 | 0.35 |
| P0CK56 | Uncharacterized protein BDLF4 | EBI-11725466 | 0.35 |
| P69901 | Probable protein E5B | EBI-11733364 | 0.35 |
| Q8AZK7 | Epstein-Barr nuclear antigen leader protein (EBNA-LP) (EBV nuclear antigen leader protein) (Epstein-Barr nuclear antigen 5) (EBNA-5) (EBV nuclear antigen 5) | EBI-11734159 | 0.35 |
| Q6P5D4 | Centrosomal protein of 135 kDa (Cep135) (Centrosomal protein 4) | EBI-10991106 | 0.35 |
| A2APR8 | Mitotic checkpoint serine/threonine-protein kinase BUB1 | EBI-11001201 | 0.35 |
| P14625 | Endoplasmin (94 kDa glucose-regulated protein) (GRP-94) (Heat shock protein 90 kDa beta member 1) (Tumor rejection antigen 1) (gp96 homolog) | EBI-11044830 | 0.35 |
| Q9D3R3 | Centrosomal protein of 72 kDa (Cep72) | EBI-11075393 | 0.35 |
| Q6ZQ29 | Serine/threonine-protein kinase TAO2 (EC 2.7.11.1) (Thousand and one amino acid protein 2) | EBI-11075869 | 0.35 |
| Q6NXE6 | Armadillo repeat-containing protein 6 | EBI-11080193 | 0.35 |
| Q96RT8 | Gamma-tubulin complex component 5 (GCP-5) | EBI-11083232 | 0.35 |
| P51114 | RNA-binding protein FXR1 (FMR1 autosomal homolog 1) (hFXR1p) | EBI-11117520 | 0.35 |
| Q7Z333 | Probable helicase senataxin (EC 3.6.4.-) (Amyotrophic lateral sclerosis 4 protein) (SEN1 homolog) (Senataxin) | EBI-11117520 | 0.35 |
| Q5VW52 | Glycerol-3-phosphate acyltransferase 1, mitochondrial (EC 2.3.1.15) | EBI-11117520 | 0.35 |
| P27824 | Calnexin (IP90) (Major histocompatibility complex class I antigen-binding protein p88) (p90) | EBI-11117520 | 0.35 |
| P16234 | Platelet-derived growth factor receptor alpha (PDGF-R-alpha) (PDGFR-alpha) (EC 2.7.10.1) (Alpha platelet-derived growth factor receptor) (Alpha-type platelet-derived growth factor receptor) (CD140 antigen-like family member A) (CD140a antigen) (Platelet-derived growth factor alpha receptor) (Platelet-derived growth factor receptor 2) (PDGFR-2) (CD antigen CD140a) | EBI-11134723 | 0.35 |
| P03428 | Polymerase basic protein 2 (RNA-directed RNA polymerase subunit P3) | EBI-12580574 | 0.35 |
| Q6IQ23 | Pleckstrin homology domain-containing family A member 7 (PH domain-containing family A member 7) | EBI-16398399 | 0.35 |
| P20036 | HLA class II histocompatibility antigen, DP alpha 1 chain (DP(W3)) (DP(W4)) (HLA-SB alpha chain) (MHC class II DP3-alpha) (MHC class II DPA1) | EBI-21511890 | 0.35 |
| Q01814 | Plasma membrane calcium-transporting ATPase 2 (PMCA2) (EC 7.2.2.10) (Plasma membrane calcium ATPase isoform 2) (Plasma membrane calcium pump isoform 2) | EBI-21599092 | 0.35 |
| Q9H8H2 | Probable ATP-dependent RNA helicase DDX31 (EC 3.6.4.13) (DEAD box protein 31) (Helicain) | EBI-21616235 | 0.35 |
| Q8NI29 | F-box only protein 27 (F-box/G-domain protein 5) | EBI-21693789 | 0.35 |
| Q9UHG3 | Prenylcysteine oxidase 1 (EC 1.8.3.5) (Prenylcysteine lyase) | EBI-21693789 | 0.35 |
| Q9UBQ6 | Exostosin-like 2 (EC 2.4.1.223) (Alpha-1,4-N-acetylhexosaminyltransferase EXTL2) (Alpha-GalNAcT EXTL2) (EXT-related protein 2) (Glucuronyl-galactosyl-proteoglycan 4-alpha-N-acetylglucosaminyltransferase) [Cleaved into: Processed exostosin-like 2] | EBI-21693789 | 0.35 |
| Q9P273 | Teneurin-3 (Ten-3) (Protein Odd Oz/ten-m homolog 3) (Tenascin-M3) (Ten-m3) (Teneurin transmembrane protein 3) | EBI-21693789 | 0.35 |
| Q9NYQ6 | Cadherin EGF LAG seven-pass G-type receptor 1 (Cadherin family member 9) (Flamingo homolog 2) (hFmi2) | EBI-21693789 | 0.35 |
| Q9NX40 | OCIA domain-containing protein 1 (Ovarian cancer immunoreactive antigen domain containing 1) (Ovarian carcinoma immunoreactive antigen) | EBI-21693789 | 0.35 |
| Q9H0V9 | VIP36-like protein (Lectin mannose-binding 2-like) (LMAN2-like protein) | EBI-21693789 | 0.35 |
| Q9BV94 | ER degradation-enhancing alpha-mannosidase-like protein 2 | EBI-21693789 | 0.35 |
| Q8NFZ4 | Neuroligin-2 | EBI-21693789 | 0.35 |
| Q8NBM8 | Prenylcysteine oxidase-like (EC 1.8.3.-) | EBI-21693789 | 0.35 |
| Q6V0I7 | Protocadherin Fat 4 (hFat4) (Cadherin family member 14) (FAT tumor suppressor homolog 4) (Fat-like cadherin protein FAT-J) | EBI-21693789 | 0.35 |
| Q6PKC3 | Thioredoxin domain-containing protein 11 (EF-hand-binding protein 1) | EBI-21693789 | 0.35 |
| Q5SRI9 | Glycoprotein endo-alpha-1,2-mannosidase (Endo-alpha mannosidase) (Endomannosidase) (hEndo) (EC 3.2.1.130) (Mandaselin) | EBI-21693789 | 0.35 |
| Q5JTY5 | Zinc-regulated GTPase metalloprotein activator 1C (EC 3.6.5.-) (Cobalamin synthase W domain-containing protein 3) (COBW domain-containing protein 3) | EBI-21693789 | 0.35 |
| Q58EX2 | Protein sidekick-2 | EBI-21693789 | 0.35 |
| Q13332 | Receptor-type tyrosine-protein phosphatase S (R-PTP-S) (EC 3.1.3.48) (Receptor-type tyrosine-protein phosphatase sigma) (R-PTP-sigma) | EBI-21693789 | 0.35 |
| P53708 | Integrin alpha-8 [Cleaved into: Integrin alpha-8 heavy chain; Integrin alpha-8 light chain] | EBI-21693789 | 0.35 |
| P41273 | Tumor necrosis factor ligand superfamily member 9 (4-1BB ligand) (4-1BBL) | EBI-21693789 | 0.35 |
| P33908 | Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA (EC 3.2.1.113) (Man(9)-alpha-mannosidase) (Man9-mannosidase) (Mannosidase alpha class 1A member 1) (Processing alpha-1,2-mannosidase IA) (Alpha-1,2-mannosidase IA) | EBI-21693789 | 0.35 |
| P10586 | Receptor-type tyrosine-protein phosphatase F (EC 3.1.3.48) (Leukocyte common antigen related) (LAR) | EBI-21693789 | 0.35 |
| O60476 | Mannosyl-oligosaccharide 1,2-alpha-mannosidase IB (EC 3.2.1.113) (Mannosidase alpha class 1A member 2) (Processing alpha-1,2-mannosidase IB) (Alpha-1,2-mannosidase IB) | EBI-21693789 | 0.35 |
| Q6ZRI8 | Rho GTPase-activating protein 36 | EBI-21744920 | 0.35 |
| O15063 | Granule associated Rac and RHOG effector protein 1 (GARRE1) | EBI-21830964 | 0.35 |
| Q6P158 | Putative ATP-dependent RNA helicase DHX57 (EC 3.6.4.13) (DEAH box protein 57) | EBI-21831097 | 0.35 |
| Q96AT9 | Ribulose-phosphate 3-epimerase (EC 5.1.3.1) (Ribulose-5-phosphate-3-epimerase) | EBI-21831245 | 0.35 |
| P05067 | Amyloid-beta precursor protein (APP) (ABPP) (APPI) (Alzheimer disease amyloid A4 protein homolog) (Alzheimer disease amyloid protein) (Amyloid precursor protein) (Amyloid-beta (A4) precursor protein) (Amyloid-beta A4 protein) (Cerebral vascular amyloid peptide) (CVAP) (PreA4) (Protease nexin-II) (PN-II) [Cleaved into: N-APP; Soluble APP-alpha (S-APP-alpha); Soluble APP-beta (S-APP-beta); C99 (Beta-secretase C-terminal fragment) (Beta-CTF); Amyloid-beta protein 42 (Abeta42) (Beta-APP42); Amyloid-beta protein 40 (Abeta40) (Beta-APP40); C83 (Alpha-secretase C-terminal fragment) (Alpha-CTF); P3(42); P3(40); C80; Gamma-secretase C-terminal fragment 59 (Amyloid intracellular domain 59) (AICD-59) (AID(59)) (Gamma-CTF(59)); Gamma-secretase C-terminal fragment 57 (Amyloid intracellular domain 57) (AICD-57) (AID(57)) (Gamma-CTF(57)); Gamma-secretase C-terminal fragment 50 (Amyloid intracellular domain 50) (AICD-50) (AID(50)) (Gamma-CTF(50)); C31] | EBI-15960333 | 0.68 |
| Q9H4B6 | Protein salvador homolog 1 (45 kDa WW domain protein) (hWW45) | EBI-16425156 | 0.37 |
| Q96RS6 | NudC domain-containing protein 1 (Chronic myelogenous leukemia tumor antigen 66) (Tumor antigen CML66) | EBI-20723339 | 0.35 |
| Q9HCE5 | N6-adenosine-methyltransferase non-catalytic subunit (Methyltransferase-like protein 14) (hMETTL14) | EBI-20595531 | 0.35 |
| Q9NZV6 | Methionine-R-sulfoxide reductase B1 (MsrB1) (EC 1.8.4.12) (EC 1.8.4.14) (Selenoprotein X) (SelX) | EBI-20976398 | 0.67 |
| Q5S007 | Leucine-rich repeat serine/threonine-protein kinase 2 (EC 2.7.11.1) (EC 3.6.5.-) (Dardarin) | EBI-21360986 | 0.35 |
| Q9NRD1 | F-box only protein 6 (F-box protein that recognizes sugar chains 2) (F-box/G-domain protein 2) | EBI-21259874 | 0.35 |
| Q14108 | Lysosome membrane protein 2 (85 kDa lysosomal membrane sialoglycoprotein) (LGP85) (CD36 antigen-like 2) (Lysosome membrane protein II) (LIMP II) (Scavenger receptor class B member 2) (CD antigen CD36) | EBI-21264396 | 0.35 |
| Q9Y275 | Tumor necrosis factor ligand superfamily member 13B (B lymphocyte stimulator) (BLyS) (B-cell-activating factor) (BAFF) (Dendritic cell-derived TNF-like molecule) (TNF- and APOL-related leukocyte expressed ligand 1) (TALL-1) (CD antigen CD257) [Cleaved into: Tumor necrosis factor ligand superfamily member 13b, membrane form; Tumor necrosis factor ligand superfamily member 13b, soluble form] | EBI-21266480 | 0.35 |
| Q16799 | Reticulon-1 (Neuroendocrine-specific protein) | EBI-21368794 | 0.37 |
| Q15185 | Prostaglandin E synthase 3 (EC 5.3.99.3) (Cytosolic prostaglandin E2 synthase) (cPGES) (Hsp90 co-chaperone) (Progesterone receptor complex p23) (Telomerase-binding protein p23) | EBI-21370704 | 0.00 |
| Q9UBU8 | Mortality factor 4-like protein 1 (MORF-related gene 15 protein) (Protein MSL3-1) (Transcription factor-like protein MRG15) | EBI-21370901 | 0.00 |
| Q96PY5 | Formin-like protein 2 (Formin homology 2 domain-containing protein 2) | EBI-21371604 | 0.00 |
| P11766 | Alcohol dehydrogenase class-3 (EC 1.1.1.1) (Alcohol dehydrogenase 5) (Alcohol dehydrogenase class chi chain) (Alcohol dehydrogenase class-III) (Glutathione-dependent formaldehyde dehydrogenase) (FALDH) (FDH) (GSH-FDH) (EC 1.1.1.-) (S-(hydroxymethyl)glutathione dehydrogenase) (EC 1.1.1.284) | EBI-21372154 | 0.00 |
| Q7Z699 | Sprouty-related, EVH1 domain-containing protein 1 (Spred-1) (hSpred1) | EBI-21372907 | 0.00 |
| P14868 | Aspartate--tRNA ligase, cytoplasmic (EC 6.1.1.12) (Aspartyl-tRNA synthetase) (AspRS) (Cell proliferation-inducing gene 40 protein) | EBI-21372879 | 0.00 |
| P36957 | Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial (EC 2.3.1.61) (2-oxoglutarate dehydrogenase complex component E2) (OGDC-E2) (Dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex) (E2K) | EBI-21373212 | 0.00 |
| Q7Z698 | Sprouty-related, EVH1 domain-containing protein 2 (Spred-2) | EBI-21373545 | 0.00 |
| Q9UL68 | Myelin transcription factor 1-like protein (MyT1-L) (MyT1L) | EBI-21374623 | 0.00 |
| O75592 | E3 ubiquitin-protein ligase MYCBP2 (EC 2.3.2.33) (Myc-binding protein 2) (Protein associated with Myc) | EBI-21374795 | 0.00 |
| Q86TG7 | Retrotransposon-derived protein PEG10 (Embryonal carcinoma differentiation-regulated protein) (Mammalian retrotransposon-derived protein 2) (Myelin expression factor 3-like protein 1) (MEF3-like protein 1) (Paternally expressed gene 10 protein) (Retrotransposon gag domain-containing protein 3) (Retrotransposon-derived gag-like polyprotein) (Ty3/Gypsy-like protein) | EBI-21374847 | 0.00 |
| P02794 | Ferritin heavy chain (Ferritin H subunit) (EC 1.16.3.1) (Cell proliferation-inducing gene 15 protein) [Cleaved into: Ferritin heavy chain, N-terminally processed] | EBI-21376448 | 0.00 |
| Q6AI39 | BRD4-interacting chromatin-remodeling complex-associated protein-like (Glioma tumor suppressor candidate region gene 1 protein-like) | EBI-21376290 | 0.00 |
| Q6GYQ0 | Ral GTPase-activating protein subunit alpha-1 (GAP-related-interacting partner to E12) (GRIPE) (GTPase-activating Rap/Ran-GAP domain-like 1) (Tuberin-like protein 1) (p240) | EBI-21376644 | 0.00 |
| Q96EK5 | KIF-binding protein (KIF1-binding protein) (Kinesin family binding protein) | EBI-21377229 | 0.00 |
| Q00994 | Protein BEX3 (Brain-expressed X-linked protein 3) (Nerve growth factor receptor-associated protein 1) (Ovarian granulosa cell 13.0 kDa protein HGR74) (p75NTR-associated cell death executor) | EBI-21377480 | 0.00 |
| F8VWT9 | Probable E3 ubiquitin-protein ligase HECTD4 | EBI-21378210 | 0.00 |
| Q13439 | Golgin subfamily A member 4 (256 kDa golgin) (Golgin-245) (Protein 72.1) (Trans-Golgi p230) | EBI-21378008 | 0.00 |
| P08238 | Heat shock protein HSP 90-beta (HSP 90) (Heat shock 84 kDa) (HSP 84) (HSP84) | EBI-21379316 | 0.00 |
| P07900 | Heat shock protein HSP 90-alpha (EC 3.6.4.10) (Heat shock 86 kDa) (HSP 86) (HSP86) (Lipopolysaccharide-associated protein 2) (LAP-2) (LPS-associated protein 2) (Renal carcinoma antigen NY-REN-38) | EBI-21379300 | 0.00 |
| Q6ZMI3 | Gliomedin [Cleaved into: Gliomedin shedded ectodomain] | EBI-21379522 | 0.00 |
| Q5SZL2 | Centrosomal protein of 85 kDa-like (Serologically defined breast cancer antigen NY-BR-15) | EBI-21380088 | 0.00 |
| P26367 | Paired box protein Pax-6 (Aniridia type II protein) (Oculorhombin) | EBI-21381283 | 0.00 |
| Q9NR80 | Rho guanine nucleotide exchange factor 4 (APC-stimulated guanine nucleotide exchange factor 1) (Asef) (Asef1) | EBI-21381216 | 0.00 |
| Q9UBW8 | COP9 signalosome complex subunit 7a (SGN7a) (Signalosome subunit 7a) (Dermal papilla-derived protein 10) (JAB1-containing signalosome subunit 7a) | EBI-21381443 | 0.00 |
| Q9Y575 | Ankyrin repeat and SOCS box protein 3 (ASB-3) | EBI-21381570 | 0.00 |
| P48426 | Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha (EC 2.7.1.149) (1-phosphatidylinositol 5-phosphate 4-kinase 2-alpha) (Diphosphoinositide kinase 2-alpha) (PIP5KIII) (Phosphatidylinositol 5-Phosphate 4-Kinase) (PI5P4Kalpha) (Phosphatidylinositol 5-phosphate 4-kinase type II alpha) (PI(5)P 4-kinase type II alpha) (PIP4KII-alpha) (PtdIns(4)P-5-kinase B isoform) (PtdIns(4)P-5-kinase C isoform) (PtdIns(5)P-4-kinase isoform 2-alpha) | EBI-21382180 | 0.00 |
| Q9BZ95 | Histone-lysine N-methyltransferase NSD3 (EC 2.1.1.370) (EC 2.1.1.371) (Nuclear SET domain-containing protein 3) (Protein whistle) (WHSC1-like 1 isoform 9 with methyltransferase activity to lysine) (Wolf-Hirschhorn syndrome candidate 1-like protein 1) (WHSC1-like protein 1) | EBI-21382818 | 0.00 |
| Q9NVR2 | Integrator complex subunit 10 (Int10) | EBI-21383211 | 0.00 |
| Q9NWB6 | Arginine and glutamate-rich protein 1 | EBI-21383120 | 0.00 |
| Q5VTB9 | E3 ubiquitin-protein ligase RNF220 (EC 2.3.2.27) (RING finger protein 220) (RING-type E3 ubiquitin transferase RNF220) | EBI-21383239 | 0.00 |
| P53041 | Serine/threonine-protein phosphatase 5 (PP5) (EC 3.1.3.16) (Protein phosphatase T) (PP-T) (PPT) | EBI-21383361 | 0.00 |
| P31321 | cAMP-dependent protein kinase type I-beta regulatory subunit | EBI-21383806 | 0.00 |
| Q9NPF5 | DNA methyltransferase 1-associated protein 1 (DNMAP1) (DNMT1-associated protein 1) | EBI-21384190 | 0.00 |
| Q58WW2 | DDB1- and CUL4-associated factor 6 (Androgen receptor complex-associated protein) (ARCAP) (IQ motif and WD repeat-containing protein 1) (Nuclear receptor interaction protein) (NRIP) | EBI-21383966 | 0.00 |
| Q6NUQ1 | RAD50-interacting protein 1 (RAD50 interactor 1) (HsRINT-1) (RINT-1) | EBI-21385792 | 0.00 |
| Q9BXM7 | Serine/threonine-protein kinase PINK1, mitochondrial (EC 2.7.11.1) (BRPK) (PTEN-induced putative kinase protein 1) | EBI-21386538 | 0.00 |
| Q07890 | Son of sevenless homolog 2 (SOS-2) | EBI-21387074 | 0.00 |
| Q99615 | DnaJ homolog subfamily C member 7 (Tetratricopeptide repeat protein 2) (TPR repeat protein 2) | EBI-21387981 | 0.00 |
| P26640 | Valine--tRNA ligase (EC 6.1.1.9) (Protein G7a) (Valyl-tRNA synthetase) (ValRS) | EBI-21388258 | 0.00 |
| Q15059 | Bromodomain-containing protein 3 (RING3-like protein) | EBI-21389314 | 0.00 |
| Q9C093 | Sperm flagellar protein 2 (Protein KPL2) | EBI-21389142 | 0.00 |
| Q9H974 | Queuine tRNA-ribosyltransferase accessory subunit 2 (Queuine tRNA-ribosyltransferase domain-containing protein 1) | EBI-21389084 | 0.00 |
| Q96MT8 | Centrosomal protein of 63 kDa (Cep63) | EBI-21389423 | 0.00 |
| Q14515 | SPARC-like protein 1 (High endothelial venule protein) (Hevin) (MAST 9) | EBI-21390086 | 0.00 |
| Q96K75 | Zinc finger protein 514 | EBI-21390447 | 0.00 |
| Q92610 | Zinc finger protein 592 | EBI-21392680 | 0.00 |
| Q9Y2B5 | VPS9 domain-containing protein 1 (Protein ATP-BL) | EBI-21392543 | 0.00 |
| P27918 | Properdin (Complement factor P) | EBI-21995211 | 0.35 |
| P37840 | Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP) | EBI-25295611 | 0.66 |
| P0DOF2 | Matrix protein (Phosphoprotein M2) | EBI-25603126 | 0.35 |
| O96028 | Histone-lysine N-methyltransferase NSD2 (EC 2.1.1.357) (Multiple myeloma SET domain-containing protein) (MMSET) (Nuclear SET domain-containing protein 2) (Protein trithorax-5) (Wolf-Hirschhorn syndrome candidate 1 protein) | EBI-25486814 | 0.35 |
| Q9BY14 | Testis-expressed protein 101 (Cell surface receptor NYD-SP8) (Scleroderma-associated autoantigen) (Spermatogenesis-related gene protein) | EBI-25505396 | 0.35 |
| P0DTC3 | ORF3a protein (ORF3a) (Accessory protein 3a) (Protein 3a) (Protein U274) (Protein X1) | EBI-25686340 | 0.35 |
| P0DTC8 | ORF8 protein (ORF8) (Non-structural protein 8) (ns8) | EBI-25687968 | 0.35 |
| Q5EP34 | Polymerase acidic protein (EC 3.1.-.-) (RNA-directed RNA polymerase subunit P2) | EBI-25773054 | 0.35 |
| Q15672 | Twist-related protein 1 (Class A basic helix-loop-helix protein 38) (bHLHa38) (H-twist) | EBI-25824698 | 0.37 |
| P78352 | Disks large homolog 4 (Postsynaptic density protein 95) (PSD-95) (Synapse-associated protein 90) (SAP-90) (SAP90) | EBI-26509146 | 0.37 |
| Q9BYB0 | SH3 and multiple ankyrin repeat domains protein 3 (Shank3) (Proline-rich synapse-associated protein 2) (ProSAP2) | EBI-26513929 | 0.37 |
| Q8N488 | RING1 and YY1-binding protein (Apoptin-associating protein 1) (APAP-1) (Death effector domain-associated factor) (DED-associated factor) (YY1 and E4TF1-associated factor 1) | EBI-27111302 | 0.35 |
| P20794 | Serine/threonine-protein kinase MAK (EC 2.7.11.1) (Male germ cell-associated kinase) | EBI-28934658 | 0.35 |
| Q8NI60 | Atypical kinase COQ8A, mitochondrial (EC 2.7.-.-) (Chaperone activity of bc1 complex-like) (Chaperone-ABC1-like) (Coenzyme Q protein 8A) (aarF domain-containing protein kinase 3) | EBI-28943519 | 0.35 |
| Q9H5K3 | Protein O-mannose kinase (POMK) (EC 2.7.1.183) (Protein kinase-like protein SgK196) (Sugen kinase 196) | EBI-28948637 | 0.35 |
| Q16832 | Discoidin domain-containing receptor 2 (Discoidin domain receptor 2) (EC 2.7.10.1) (CD167 antigen-like family member B) (Discoidin domain-containing receptor tyrosine kinase 2) (Neurotrophic tyrosine kinase, receptor-related 3) (Receptor protein-tyrosine kinase TKT) (Tyrosine-protein kinase TYRO10) (CD antigen CD167b) | EBI-32717626 | 0.42 |
| P11362 | Fibroblast growth factor receptor 1 (FGFR-1) (EC 2.7.10.1) (Basic fibroblast growth factor receptor 1) (BFGFR) (bFGF-R-1) (Fms-like tyrosine kinase 2) (FLT-2) (N-sam) (Proto-oncogene c-Fgr) (CD antigen CD331) | EBI-32718427 | 0.35 |
| Q16288 | NT-3 growth factor receptor (EC 2.7.10.1) (GP145-TrkC) (Trk-C) (Neurotrophic tyrosine kinase receptor type 3) (TrkC tyrosine kinase) | EBI-32719212 | 0.35 |
| P09619 | Platelet-derived growth factor receptor beta (PDGF-R-beta) (PDGFR-beta) (EC 2.7.10.1) (Beta platelet-derived growth factor receptor) (Beta-type platelet-derived growth factor receptor) (CD140 antigen-like family member B) (Platelet-derived growth factor receptor 1) (PDGFR-1) (CD antigen CD140b) | EBI-32719373 | 0.35 |
| P07949 | Proto-oncogene tyrosine-protein kinase receptor Ret (EC 2.7.10.1) (Cadherin family member 12) (Proto-oncogene c-Ret) [Cleaved into: Soluble RET kinase fragment; Extracellular cell-membrane anchored RET cadherin 120 kDa fragment] | EBI-32719411 | 0.35 |
| P34925 | Tyrosine-protein kinase RYK (EC 2.7.10.1) | EBI-32719634 | 0.35 |
| Q06418 | Tyrosine-protein kinase receptor TYRO3 (EC 2.7.10.1) (Tyrosine-protein kinase BYK) (Tyrosine-protein kinase DTK) (Tyrosine-protein kinase RSE) (Tyrosine-protein kinase SKY) (Tyrosine-protein kinase TIF) | EBI-32719716 | 0.35 |
Database | Links |
| UNIPROT | P10909 B2R9Q1 B3KSE6 P11380 P11381 Q2TU75 Q5HYC1 Q7Z5B9 |
| Pfam | PF01093 |
| PROSITE | PS00492 PS00493 |
| OMIM | 185430 |
| DisGeNET | 1191 |
National and Kapodistrian University of Athens
Department of Biology
Biophysics & Bioinformatics Laboratory