NucEnvDB

NucEnvDB

A database of Nuclear Envelope Proteins and their Interactions

Calcium-binding protein 8 - Homo sapiens - NucEnvDB

Calcium-binding protein 8 (Homo sapiens)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	Calcium-binding protein 8
Accession Code	Q9BXU9
Gene	CALN1
Organism	Homo sapiens \| Human (Taxonomy: 9606)
Part of Reference Proteome?	Yes
Sequence (Length: 261)
MRLPEQPGEGKPENEKKGDGGALGGGEEPPRSQAPDFPTWEKMPFHHVTAGLLYKGNYLNRSLSAGSDSEQLANISVEELDEIREAFRVLDRDGNGFISKQELGMAMRSLGYMPSEVELAIIMQRLDMDG DGQVDFDEFMTILGPKLVSSEGRDGFLGNTIDSIFWQFDMQRITLEELKHILYHAFRDHLTMKDIENIIINEEESLNETSGNCQTEFEGVHSQKQNRQTCVRKSLICAFAMAFIISVMLIAANQILRSGM E

Subcellular Location

Description
Golgi apparatus, trans-Golgi network membrane {Curator InferencePubMed:19338761}; Single-pass type IV membrane protein {Curator InferencePubMed:19338761}. Cytoplasm, perinuclear region {ECO:0000269\|PubMed:19338761}. Cell membrane {Curator InferencePubMed:19338761}; Single-pass type IV membrane protein {Curator InferencePubMed:19338761}.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Transmembrane	UniProt	Sequence Analysis {ECO:0000255}
Assigned Ontology terms

Cellular Component	Perinuclear Region Of Cytoplasm (GO:0048471) Plasma Membrane (GO:0005886) Trans-Golgi Network Membrane (GO:0032588)

Biology & Function

Description
Negatively regulates Golgi-to-plasma membrane trafficking by interacting with PI4KB and inhibiting its activity. May play a role in the physiology of neurons and is potentially important in memory and learning. {By SimilarityUniProtKB:Q06BI3}.
Assigned Ontology terms

Biological Process
Molecular Function	Calcium Ion Binding (GO:0005509)

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (1 interactors)

Partner (NucEnvDB)		IntAct	Confidence score
P62166	Neuronal calcium sensor 1	EBI-21458640	0.27
Interactions with other proteins (10 interactors)

Partner (UniProt)		IntAct	Confidence score
Q96LL9	DnaJ homolog subfamily C member 30, mitochondrial (Williams-Beuren syndrome chromosomal region 18 protein)	EBI-24625155	0.56
Q9NZ43	Vesicle transport protein USE1 (Putative MAPK-activating protein PM26) (USE1-like protein) (p31)	EBI-24630791	0.56
Q969F0	Fetal and adult testis-expressed transcript protein (Cancer/testis antigen 43) (CT43) (Tumor antigen BJ-HCC-2)	EBI-24388353	0.56
Q96IW7	Vesicle-trafficking protein SEC22a (SEC22 vesicle-trafficking protein homolog A) (SEC22 vesicle-trafficking protein-like 2)	EBI-24542608	0.56
P60201	Myelin proteolipid protein (PLP) (Lipophilin)	EBI-24602587	0.56
P21145	Myelin and lymphocyte protein (T-lymphocyte maturation-associated protein)	EBI-24638394	0.56
P03973	Antileukoproteinase (ALP) (BLPI) (HUSI-1) (Mucus proteinase inhibitor) (MPI) (Protease inhibitor WAP4) (Secretory leukocyte protease inhibitor) (Seminal proteinase inhibitor) (WAP four-disulfide core domain protein 4)	EBI-24807681	0.56
Q9H400	Lck-interacting transmembrane adapter 1 (Lck-interacting membrane protein) (Lck-interacting molecule)	EBI-25271079	0.56
Q58WW2	DDB1- and CUL4-associated factor 6 (Androgen receptor complex-associated protein) (ARCAP) (IQ motif and WD repeat-containing protein 1) (Nuclear receptor interaction protein) (NRIP)	EBI-21889878	0.40
P21554	Cannabinoid receptor 1 (CB-R) (CB1) (CANN6)	EBI-21458285	0.38

Cross-References

Database	Links
UNIPROT	Q9BXU9 J3KQA7
Pfam	PF13499
PROSITE	PS00018 PS50222
OMIM	607176
DisGeNET	83698

Powered by W3.css | Privacy Notice

x

This website uses cookies to improve user experience. By using NucEnvDB you consent to all cookies in accordance with our privacy policy. OK