NucEnvDB

NucEnvDB

A database of Nuclear Envelope Proteins and their Interactions

Guanylate-binding protein 3 - Homo sapiens - NucEnvDB

Guanylate-binding protein 3 (Homo sapiens)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	Guanylate-binding protein 3
Accession Code	Q9H0R5
Gene	GBP3
Organism	Homo sapiens \| Human (Taxonomy: 9606)
Part of Reference Proteome?	Yes
Sequence (Length: 595)
MAPEIHMTGPMCLIENTNGELVANPEALKILSAITQPVVVVAIVGLYRTGKSYLMNKLAGKNKGFSLGSTVKSHTKGIWMWCVPHPKKPEHTLVLLDTEGLGDVKKGDNQNDSWIFTLAVLLSSTLVYNS MGTINQQAMDQLYYVTELTHRIRSKSSPDENENEDSADFVSFFPDFVWTLRDFSLDLEADGQPLTPDEYLEYSLKLTQGTSQKDKNFNLPRLCIRKFFPKKKCFVFDLPIHRRKLAQLEKLQDEELDPEF VQQVADFCSYIFSNSKTKTLSGGIKVNGPRLESLVLTYINAISRGDLPCMENAVLALAQIENSAAVQKAIAHYDQQMGQKVQLPAETLQELLDLHRVSEREATEVYMKNSFKDVDHLFQKKLAAQLDKKR DDFCKQNQEASSDRCSALLQVIFSPLEEEVKAGIYSKPGGYCLFIQKLQDLEKKYYEEPRKGIQAEEILQTYLKSKESVTDAILQTDQILTEKEKEIEVECVKAESAQASAKMVEEMQIKYQQMMEEKEK SYQEHVKQLTEKMERERAQLLEEQEKTLTSKLQEQARVLKERCQGESTQLQNEIQKLQKTLKKKTKRYMSHKLKI

Subcellular Location

Description
Cytoplasm {Experimental EvidencePubMed:17266443}. Cytoplasm, perinuclear region {Experimental EvidencePubMed:21151871}. Golgi apparatus membrane {Experimental EvidencePubMed:21151871}. Note=Heterodimers with GBP1, GBP2 and GBP5 localize in the compartment of the prenylated GBPs: with GBP1 in a vesicle-like compartment, with GBP2, around the nucleus and with GBP-5, at the Golgi apparatus. {Experimental EvidencePubMed:21151871}.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Unknown	UniProt	Sequence Analysis
Assigned Ontology terms

Cellular Component	Cytoplasm (GO:0005737) Cytoplasmic Vesicle (GO:0031410) Cytosol (GO:0005829) Golgi Membrane (GO:0000139) Perinuclear Region Of Cytoplasm (GO:0048471)

Biology & Function

Description
Exhibits antiviral activity against influenza virus. {Experimental EvidencePubMed:22106366}.
Assigned Ontology terms

Biological Process	Cellular Response To Type II Interferon (GO:0071346) Cellular Response To Interleukin-1 (GO:0071347) Cellular Response To Tumor Necrosis Factor (GO:0071356) Defense Response To Virus (GO:0051607)
Molecular Function	GTP Binding (GO:0005525) GTPase Activity (GO:0003924) Identical Protein Binding (GO:0042802) Protein Homodimerization Activity (GO:0042803)

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (2 interactors)

Partner (NucEnvDB)		IntAct	Confidence score
Q9H0R5	Self	EBI-26472578	0.51
P32456	Guanylate-binding protein 2	EBI-21835834	0.63
Interactions with other proteins (6 interactors)

Partner (UniProt)		IntAct	Confidence score
O95819	Mitogen-activated protein kinase kinase kinase kinase 4 (EC 2.7.11.1) (HPK/GCK-like kinase HGK) (MAPK/ERK kinase kinase kinase 4) (MEK kinase kinase 4) (MEKKK 4) (Nck-interacting kinase)	EBI-8547663	0.59
Q5NF74	Transketolase (EC 2.2.1.1)	EBI-2798928	0.00
P32455	Guanylate-binding protein 1 (EC 3.6.5.-) (GTP-binding protein 1) (GBP-1) (HuGBP-1) (Guanine nucleotide-binding protein 1) (Interferon-induced guanylate-binding protein 1)	EBI-21864916	0.63
P60903	Protein S100-A10 (Calpactin I light chain) (Calpactin-1 light chain) (Cellular ligand of annexin II) (S100 calcium-binding protein A10) (p10 protein) (p11)	EBI-20909232	0.40
P16403	Histone H1.2 (Histone H1c) (Histone H1d) (Histone H1s-1)	EBI-20912036	0.40
Q96PP8	Guanylate-binding protein 5 (EC 3.6.5.-) (GBP-TA antigen) (GTP-binding protein 5) (GBP-5) (Guanine nucleotide-binding protein 5)	EBI-26472594	0.51

Cross-References

Database	Links
UNIPROT	Q9H0R5 A2A317 A6NF86 B2RTW0 F8UW81 Q05D54 Q5T8L8 Q5T8L9 Q6P3V3 Q9NV33
Pfam	PF02263 PF02841
PROSITE	PS51715
OMIM	600413
DisGeNET	2635

Powered by W3.css | Privacy Notice

x

This website uses cookies to improve user experience. By using NucEnvDB you consent to all cookies in accordance with our privacy policy. OK