NucEnvDB

NucEnvDB

A database of Nuclear Envelope Proteins and their Interactions

Ran guanine nucleotide release factor - Mus musculus - NucEnvDB

Ran guanine nucleotide release factor (Mus musculus)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	Ran guanine nucleotide release factor
Accession Code	Q9JIB0
Gene	Rangrf
Organism	Mus musculus \| House mouse (Taxonomy: 10090)
Part of Reference Proteome?	Yes
Sequence (Length: 185)
MEPNRNCPLFGGAFSAILPTGAIDVSDLRPVPDNQEVFCHPVTDQSLIIELLELQAHVQGEAAARYHFEDVGRVQGARAVHVLSVQPLCLENLSLRGCCQDAWSLSGKQQVAKENQQVAKDVTLHQALLR LPQYQTDLLLTFNQPPCHSRSLGPENLSCPPWSLSNFEQLVTSLTLHDPNLFGPQ

Subcellular Location

Description
Nucleus {Experimental EvidencePubMed:10811801, Experimental EvidencePubMed:11733047}. Cytoplasm, perinuclear region {By SimilarityUniProtKB:Q9HD47}. Cytoplasm {Experimental EvidencePubMed:18184654}. Cell membrane {By SimilarityUniProtKB:Q9HD47}; Peripheral membrane protein {By SimilarityUniProtKB:Q9HD47}; Cytoplasmic side {By SimilarityUniProtKB:Q9HD47}. Note=Shuttles between the nucleus and cytoplasm. {Experimental EvidencePubMed:11733047}.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Peripheral	UniProt	By Similarity {ECO:0000250\|UniProtKB:Q9HD47}
Assigned Ontology terms

Cellular Component	Caveola (GO:0005901) Cytoplasm (GO:0005737) Cytosol (GO:0005829) Intercalated Disc (GO:0014704) Nucleoplasm (GO:0005654) Nucleus (GO:0005634) Perinuclear Region Of Cytoplasm (GO:0048471) Rough Endoplasmic Reticulum (GO:0005791)

Biology & Function

Description
May regulate the intracellular trafficking of RAN (PubMed:10811801, PubMed:11733047). Promotes guanine nucleotide release from RAN and inhibits binding of new GTP by preventing the binding of the RAN guanine nucleotide exchange factor RCC1 (PubMed:10811801, PubMed:11733047). Regulates the levels of GTP-bound RAN in the nucleus, and thereby plays a role in the regulation of RAN-dependent mitotic spindle dynamics (By similarity). Enhances the expression of SCN5A at the cell membrane in cardiomyocytes (PubMed:18184654, PubMed:23420830). {By SimilarityUniProtKB:Q9HD47, Experimental EvidencePubMed:10811801, Experimental EvidencePubMed:11733047, Experimental EvidencePubMed:18184654, Experimental EvidencePubMed:23420830}.
Assigned Ontology terms

Biological Process	Endoplasmic Reticulum To Golgi Vesicle-Mediated Transport (GO:0006888) Heart Contraction (GO:0060047) Nucleocytoplasmic Transport (GO:0006913) Positive Regulation Of Protein Localization To Cell Surface (GO:2000010) Positive Regulation Of Protein Localization To Plasma Membrane (GO:1903078) Protein Exit From Endoplasmic Reticulum (GO:0032527) Protein Import Into Nucleus (GO:0006606) Regulation Of Bundle Of His Cell Action Potential (GO:0098905) Regulation Of Cardiac Muscle Cell Action Potential Involved In Regulation Of Contraction (GO:0098909) Regulation Of Membrane Depolarization (GO:0003254) Regulation Of Membrane Depolarization During Cardiac Muscle Cell Action Potential (GO:1900825) Regulation Of Membrane Potential (GO:0042391) Regulation Of Microtubule Nucleation By Ran Protein Signal Transduction (GO:0090226) Regulation Of Sodium Ion Transmembrane Transport (GO:1902305) Regulation Of Sodium Ion Transmembrane Transporter Activity (GO:2000649)
Molecular Function	Guanyl-Nucleotide Exchange Factor Activity (GO:0005085) Small GTPase Binding (GO:0031267) Sodium Channel Regulator Activity (GO:0017080) Transmembrane Transporter Binding (GO:0044325)

Protein-Protein Interactions

Interactions with other proteins (2 interactors)

Partner (UniProt)		IntAct	Confidence score
Q61820	GTP-binding nuclear protein Ran, testis-specific isoform (EC 3.6.5.-)	EBI-310252	0.37
Q9Z0S9	Prenylated Rab acceptor protein 1 (PRA1 family protein 1) (Prenylin)	EBI-20974786	0.37

Cross-References

Database	Links
UNIPROT	Q9JIB0 Q9CWZ0
Pfam	PF04603

Powered by W3.css | Privacy Notice

x

This website uses cookies to improve user experience. By using NucEnvDB you consent to all cookies in accordance with our privacy policy. OK