NucEnvDB

NucEnvDB

A database of Nuclear Envelope Proteins and their Interactions

B-cell lymphoma/leukemia 10 - Rattus norvegicus - NucEnvDB

B-cell lymphoma/leukemia 10 (Rattus norvegicus)

FASTA TEXT XML

Subcellular Location Biology & Function Cross-References

General Information

Protein Information
Protein Name	B-cell lymphoma/leukemia 10
Accession Code	Q9QYN5
Gene	Bcl10
Organism	Rattus norvegicus \| Norway rat (Taxonomy: 10116)
Part of Reference Proteome?	Yes
Sequence (Length: 233)
MEAPAPSLTEEDLTEVKKDALENLRVYLCEKIIAERHFDHLRAKKILSREDTEEISCRTSSRKRAGKLLDYLQENPKGLDTLVESIRREKTQNFLIQKITDEVLKLRNIKLEHLKGLKCSSCEPFAAGAT NNLSRSNSDESNFSEKQRPSTVIYHPEGESSTAPFFSTESSLNLPVLEVGRLENSSFSSASLPRPGDPGAPPLPPDLRLEEGGSCGNSSEMFLPLRSRALSRQ

Subcellular Location

Description
Cytoplasm, perinuclear region {By SimilarityUniProtKB:O95999}. Membrane raft {By SimilarityUniProtKB:O95999}. Note=Appears to have a perinuclear, compact and filamentous pattern of expression. Also found in the nucleus of several types of tumor cells. Colocalized with DPP4 in membrane rafts. {By SimilarityUniProtKB:O95999}.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Unknown	UniProt	Sequence Analysis
Assigned Ontology terms

Cellular Component	CBM Complex (GO:0032449) Cytoplasm (GO:0005737) Cytoplasmic Microtubule (GO:0005881) Cytosol (GO:0005829) Immunological Synapse (GO:0001772) Lysosome (GO:0005764) Membrane Raft (GO:0045121) Nucleus (GO:0005634) Perinuclear Region Of Cytoplasm (GO:0048471) Polkadots (GO:0002096) Protein-Containing Complex (GO:0032991)

Biology & Function

Description
Plays a key role in both adaptive and innate immune signaling by bridging CARD domain-containing proteins to immune activation. Acts by channeling adaptive and innate immune signaling downstream of CARD domain-containing proteins CARD9, CARD11 and CARD14 to activate NF- kappa-B and MAP kinase p38 (MAPK11, MAPK12, MAPK13 and/or MAPK14) pathways which stimulate expression of genes encoding pro-inflammatory cytokines and chemokines. Recruited by activated CARD domain-containing proteins: homooligomerized CARD domain-containing proteins form a nucleating helical template that recruits BCL10 via CARD-CARD interaction, thereby promoting polymerization of BCL10, subsequent recruitment of MALT1 and formation of a CBM complex. This leads to activation of NF-kappa-B and MAP kinase p38 (MAPK11, MAPK12, MAPK13 and/or MAPK14) pathways which stimulate expression of genes encoding pro-inflammatory cytokines and chemokines. Activated by CARD9 downstream of C-type lectin receptors; CARD9-mediated signals are essential for antifungal immunity. Activated by CARD11 downstream of T- cell receptor (TCR) and B-cell receptor (BCR). Promotes apoptosis, pro- caspase-9 maturation and activation of NF-kappa-B via NIK and IKK. {By SimilarityUniProtKB:O95999}.
Assigned Ontology terms

Biological Process	Adaptive Immune Response (GO:0002250) Antifungal Innate Immune Response (GO:0061760) B Cell Apoptotic Process (GO:0001783) Cell Death (GO:0008219) Cellular Defense Response (GO:0006968) Cellular Response To Lipopolysaccharide (GO:0071222) Cellular Response To Mechanical Stimulus (GO:0071260) I-KappaB Kinase/NF-KappaB Signaling (GO:0007249) Immunoglobulin Mediated Immune Response (GO:0016064) Innate Immune Response (GO:0045087) Lipopolysaccharide-Mediated Signaling Pathway (GO:0031663) Negative Regulation Of Mature B Cell Apoptotic Process (GO:0002906) Neural Tube Closure (GO:0001843) Positive Regulation Of Apoptotic Process (GO:0043065) Positive Regulation Of Cysteine-Type Endopeptidase Activity Involved In Apoptotic Process (GO:0043280) Positive Regulation Of Cytokine Production (GO:0001819) Positive Regulation Of DNA-Templated Transcription (GO:0045893) Positive Regulation Of Extrinsic Apoptotic Signaling Pathway (GO:2001238) Positive Regulation Of I-KappaB Kinase/NF-KappaB Signaling (GO:0043123) Positive Regulation Of Interleukin-8 Production (GO:0032757) Positive Regulation Of NF-KappaB Transcription Factor Activity (GO:0051092) Positive Regulation Of Phosphorylation (GO:0042327) Positive Regulation Of Protein Ubiquitination (GO:0031398) Positive Regulation Of T Cell Activation (GO:0050870) Positive Regulation Of T Cell Receptor Signaling Pathway (GO:0050862) Protein Homooligomerization (GO:0051260) Regulation Of T Cell Receptor Signaling Pathway (GO:0050856) Response To Food (GO:0032094) Response To Fungus (GO:0009620) T Cell Apoptotic Process (GO:0070231) T Cell Receptor Signaling Pathway (GO:0050852) Toll-Like Receptor Signaling Pathway (GO:0002224)
Molecular Function	CARD Domain Binding (GO:0050700) Enzyme Binding (GO:0019899) General Transcription Initiation Factor Binding (GO:0140296) Identical Protein Binding (GO:0042802) Kinase Activator Activity (GO:0019209) Kinase Binding (GO:0019900) NF-KappaB Binding (GO:0051059) Protease Binding (GO:0002020) Protein C-Terminus Binding (GO:0008022) Protein Kinase B Binding (GO:0043422) Protein Kinase Binding (GO:0019901) Protein Self-Association (GO:0043621) Protein-Containing Complex Binding (GO:0044877) Transcription Coactivator Activity (GO:0003713) Ubiquitin Protein Ligase Binding (GO:0031625)

Cross-References

Database	Links
UNIPROT	Q9QYN5
Pfam	PF00619
PROSITE	PS50209

Powered by W3.css | Privacy Notice

x

This website uses cookies to improve user experience. By using NucEnvDB you consent to all cookies in accordance with our privacy policy. OK