NucEnvDB

NucEnvDB

A database of Nuclear Envelope Proteins and their Interactions

Protein NDRG2 - Homo sapiens - NucEnvDB

Protein NDRG2 (Homo sapiens)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	Protein NDRG2
Accession Code	Q9UN36
Gene	NDRG2
Organism	Homo sapiens \| Human (Taxonomy: 9606)
Part of Reference Proteome?	Yes
Sequence (Length: 371)
MAELQEVQITEEKPLLPGQTPEAAKEAELAARILLDQGQTHSVETPYGSVTFTVYGTPKPKRPAILTYHDVGLNYKSCFQ PLFQFEDMQEIIQNFVRVHVDAPGMEEGAPVFPLGYQYPSLDQLADMIPCVLQYLNFSTIIGVGVGAGAYILARYALNHP DTVEGLVLINIDPNAKGWMDWAAHKLTGLTSSIPEMILGHLFSQEELSGNSELIQKYRNIITHAPNLDNIELYWNSYNNR RDLNFERGGDITLRCPVMLVVGDQAPHEDAVVECNSKLDPTQTSFLKMADSGGQPQLTQPGKLTEAFKYFLQGMGYMASS CMTRLSRSRTASLTSAASVDGNRSRSRTLSQSSESGTLSSGPPGHTMEVSC

Structure Viewer (PDB: 2XMQ)

Subcellular Location

Description
Cytoplasm. Cytoplasm, perinuclear region. Cell projection, growth cone {By Similarity}. Note=In neurons, seems to concentrate at axonal growth cone. Perinuclear in neurons (By similarity). {By Similarity}.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Unknown	UniProt	Sequence Analysis
Assigned Ontology terms

Cellular Component	Cytoplasm (GO:0005737) Cytosol (GO:0005829) Extracellular Exosome (GO:0070062) Golgi Apparatus (GO:0005794) Growth Cone (GO:0030426) Nucleus (GO:0005634) Perinuclear Region Of Cytoplasm (GO:0048471)

Biology & Function

Description
Contributes to the regulation of the Wnt signaling pathway. Down-regulates CTNNB1-mediated transcriptional activation of target genes, such as CCND1, and may thereby act as tumor suppressor. May be involved in dendritic cell and neuron differentiation. {Experimental EvidencePubMed:12845671, Experimental EvidencePubMed:16103061, Experimental EvidencePubMed:21247902}.
Assigned Ontology terms

Biological Process	Cell Differentiation (GO:0030154) Negative Regulation Of Cytokine Production (GO:0001818) Negative Regulation Of ERK1 And ERK2 Cascade (GO:0070373) Negative Regulation Of Vascular Associated Smooth Muscle Cell Proliferation (GO:1904706) Regulation Of Platelet-Derived Growth Factor Production (GO:0090361) Regulation Of Vascular Endothelial Growth Factor Production (GO:0010574) Signal Transduction (GO:0007165) Substantia Nigra Development (GO:0021762) Vascular Associated Smooth Muscle Cell Proliferation (GO:1990874) Wnt Signaling Pathway (GO:0016055)
Molecular Function

Protein-Protein Interactions

Interactions with other proteins (12 interactors)

Partner (UniProt)		IntAct	Confidence score
P03372	Estrogen receptor (ER) (ER-alpha) (Estradiol receptor) (Nuclear receptor subfamily 3 group A member 1)	EBI-3895740	0.53
Q9UI14	Prenylated Rab acceptor protein 1 (PRA1 family protein 1)	EBI-8084498	0.61
P35222	Catenin beta-1 (Beta-catenin)	EBI-8084686	0.35
Q96Q40	Cyclin-dependent kinase 15 (EC 2.7.11.22) (Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 7 protein) (Cell division protein kinase 15) (Serine/threonine-protein kinase ALS2CR7) (Serine/threonine-protein kinase PFTAIRE-2)	EBI-21574933	0.35
Q9UMR2	ATP-dependent RNA helicase DDX19B (EC 3.6.4.13) (DEAD box RNA helicase DEAD5) (DEAD box protein 19B)	EBI-21616596	0.35
Q92597	Protein NDRG1 (Differentiation-related gene 1 protein) (DRG-1) (N-myc downstream-regulated gene 1 protein) (Nickel-specific induction protein Cap43) (Reducing agents and tunicamycin-responsive protein) (RTP) (Rit42)	EBI-21847586	0.35
P11142	Heat shock cognate 71 kDa protein (EC 3.6.4.10) (Heat shock 70 kDa protein 8) (Lipopolysaccharide-associated protein 1) (LAP-1) (LPS-associated protein 1)	EBI-21847586	0.35
P30556	Type-1 angiotensin II receptor (AT1AR) (AT1BR) (Angiotensin II type-1 receptor) (AT1 receptor)	EBI-20802719	0.37
P51679	C-C chemokine receptor type 4 (C-C CKR-4) (CC-CKR-4) (CCR-4) (CCR4) (K5-5) (CD antigen CD194)	EBI-20804498	0.37
P10636	Microtubule-associated protein tau (Neurofibrillary tangle protein) (Paired helical filament-tau) (PHF-tau)	EBI-20749487	0.35
Q92685	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase (EC 2.4.1.258) (Asparagine-linked glycosylation protein 3 homolog) (Dol-P-Man-dependent alpha(1-3)-mannosyltransferase) (Dolichyl-P-Man:Man(5)GlcNAc(2)-PP-dolichyl mannosyltransferase) (Dolichyl-phosphate-mannose--glycolipid alpha-mannosyltransferase) (Not56-like protein)	EBI-25468455	0.37
F1PAA9	Cadherin-1 (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) [Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3]	EBI-27079701	0.27

Cross-References

Database	Links
UNIPROT	Q9UN36 B3KUE3 B4DE86 B7WP11 B7WPD5 D3DS07 D3DS10 Q567T1 Q68DW2 Q86U08 Q86U46 Q96FD3 Q96FT0 Q96JU0 Q96PN0 Q9BQH5 Q9ULH2
PDB	2XMQ 2XMR 2XMS
Pfam	PF03096
OMIM	605272
DisGeNET	57447

Powered by W3.css | Privacy Notice

x

This website uses cookies to improve user experience. By using NucEnvDB you consent to all cookies in accordance with our privacy policy. OK