NucEnvDB

NucEnvDB

A database of Nuclear Envelope Proteins and their Interactions

Protein rogdi - Drosophila melanogaster - NucEnvDB

Protein rogdi (Drosophila melanogaster)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	Protein rogdi
Accession Code	Q9VVE2
Gene	rogdi
Organism	Drosophila melanogaster (Taxonomy: 7227)
Part of Reference Proteome?	Yes
Sequence (Length: 268)
MKMLADTEREEALNLQIEFEWVLRQEVHAILKQLRSILVECAHRFPVPLYENEGKKTEKFILTVSPDQLKAVLTLTGDAITQADISFKLCKAPSQTQRTSITHDSPWKLQQVQDAANHLQTAINHIDDVD DSYHFKTSDEVLHVIGNILDALQRGRNSLLVPKKKPIDELIKGRNMKSLVPNLPEDLAVSFYLQSHKLIIAVYQLLNNQGTMRFDSRQAEASVQWLNDVLLLLMNGQKLCQQLKDKISVFSVYKDFTVGS RSPSALSY

Subcellular Location

Description
Nucleus envelope {By SimilarityUniProtKB:Q9GZN7}. Presynapse {By SimilarityUniProtKB:Q4V7D2}. Cell projection, axon {By SimilarityUniProtKB:Q4V7D2}. Perikaryon {By SimilarityUniProtKB:Q4V7D2}. Cell projection, dendrite {By SimilarityUniProtKB:Q4V7D2}. Cytoplasmic vesicle, secretory vesicle, synaptic vesicle {By SimilarityUniProtKB:Q4V7D2}. Note=Detected primarily at presynaptic sites on axons, and to a lesser degree in soma and dendrites. Not detected at post-synaptic sites. {By SimilarityUniProtKB:Q4V7D2}.
Position in the Nuclear Envelope
Location	Location ID	Description
Nuclear Envelope	SL-0178	The nuclear envelope is a membrane system which surrounds the nucleoplasm of eukaryotic cells. It is composed of the nuclear lamina, nuclear pore complexes and two nuclear membranes. The space between the two membranes is called the nuclear intermembrane space.
Membrane Topology
Topology	Source	Annotation Type
Unknown	UniProt	Sequence Analysis
Assigned Ontology terms

Cellular Component	Anchoring Junction (GO:0070161) Axon (GO:0030424) Dendrite (GO:0030425) Nuclear Envelope (GO:0005635) Perikaryon (GO:0043204) RAVE Complex (GO:0043291) Synaptic Vesicle (GO:0008021)

Biology & Function

Description
Plays a role in promoting sleep by enhancing metabotropic transmission of the inhibitory neurotransmitter gamma-aminobutyric acid (GABA) in GABAergic neurons upstream of a wake-inducing dopaminergic pathway. {Experimental EvidencePubMed:28900300}.
Assigned Ontology terms

Biological Process	Behavioral Response To Ethanol (GO:0048149) Gamma-Aminobutyric Acid Secretion, Neurotransmission (GO:0061534) Sleep (GO:0030431)
Molecular Function

Protein-Protein Interactions

Interactions with other proteins (13 interactors)

Partner (UniProt)		IntAct	Confidence score
Q9VCH1	Eukaryotic translation initiation factor 4G2, isoform A (Eukaryotic translation initiation factor 4G2, isoform C)	EBI-199512	0.00
Q9VY61	Uncharacterized protein, isoform A (Uncharacterized protein, isoform B)	EBI-216289	0.00
Q0E8K5	AT10158p (Mrityu, isoform A) (Mrityu, isoform B)	EBI-220799	0.00
Q9VVC2	Cuticle protein 6	EBI-226383	0.00
P11929	Blastoderm-specific protein 25D	EBI-234009	0.00
Q9VU23	Uncharacterized protein, isoform E	EBI-234639	0.00
Q9VYV9	LD41421p (Valette, isoform B)	EBI-258534	0.00
P10734	Zygotic gap protein knirps (Nuclear receptor subfamily 0 group A member 1)	EBI-274719	0.00
Q7K4Z4	Protein immune deficiency	EBI-278444	0.00
P62152	Calmodulin (CaM)	EBI-283358	0.00
P42287	Protein gurken	EBI-509567	0.37
P18431	Protein kinase shaggy (EC 2.7.11.1) (Protein zeste-white 3)	EBI-9925534	0.60
Q9VJQ6	Dynactin 5, p25 subunit	EBI-26734859	0.49

Cross-References

Database	Links
UNIPROT	Q9VVE2 Q32KF2 Q8IQP4 Q95T16
Pfam	PF10259

Powered by W3.css | Privacy Notice

x

This website uses cookies to improve user experience. By using NucEnvDB you consent to all cookies in accordance with our privacy policy. OK