Dexamethasone-induced Ras-related protein 1 - Homo sapiens

Dexamethasone-induced Ras-related protein 1 (Homo sapiens)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	Dexamethasone-induced Ras-related protein 1
Accession Code	Q9Y272
Gene	RASD1
Organism	Homo sapiens \| Human (Taxonomy: 9606)
Part of Reference Proteome?	Yes
Sequence (Length: 281)
MKLAAMIKKMCPSDSELSIPAKNCYRMVILGSSKVGKTAIVSRFLTGRFEDAYTPTIEDFHRKFYSIRGEVYQLDILDTSGNHPFPAMRRLSILTGDVFILVFSLDNRDSFEEVQRLRQQILDTKSCLKN KTKENVDVPLVICGNKGDRDFYREVDQREIEQLVGDDPQRCAYFEISAKKNSSLDQMFRALFAMAKLPSEMSPDLHRKVSVQYCDVLHKKALRNKKLLRAGSGGGGGDPGDAFGIVAPFARRPSVHSDLM YIREKASAGSQAKDKERCVIS

Subcellular Location

Description
Cell membrane {Curator Inference}; Lipid-anchor {Curator Inference}; Cytoplasmic side {Curator Inference}. Cytoplasm, perinuclear region {ECO:0000250}. Nucleus {ECO:0000250}.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Lipid-Anchored	UniProt	By Similarity {ECO:0000250}
Assigned Ontology terms

Cellular Component	Cytoplasm (GO:0005737) Nucleus (GO:0005634) Perinuclear Region Of Cytoplasm (GO:0048471) Plasma Membrane (GO:0005886) Sarcoplasmic Reticulum (GO:0016529)

Biology & Function

Description
Small GTPase. Negatively regulates the transcription regulation activity of the APBB1/FE65-APP complex via its interaction with APBB1/FE65 (By similarity). {By Similarity}.
Assigned Ontology terms

Biological Process	G Protein-Coupled Receptor Signaling Pathway (GO:0007186) Negative Regulation Of DNA-Templated Transcription (GO:0045892) Nitric Oxide Mediated Signal Transduction (GO:0007263) Signal Transduction (GO:0007165)
Molecular Function	G-Protein Beta-Subunit Binding (GO:0031681) GTP Binding (GO:0005525) GTPase Activity (GO:0003924)

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (2 interactors)

Partner (NucEnvDB)		IntAct	Confidence score
O94972	E3 ubiquitin-protein ligase TRIM37	EBI-10325762	0.56
O15162	Phospholipid scramblase 1	EBI-752746	0.37
Interactions with other proteins (30 interactors)

Partner (UniProt)		IntAct	Confidence score
P10588	Nuclear receptor subfamily 2 group F member 6 (V-erbA-related protein 2) (EAR-2)	EBI-4320347	0.40
Q99PV5	Class E basic helix-loop-helix protein 41 (bHLHe41) (Class B basic helix-loop-helix protein 3) (bHLHb3) (Differentially expressed in chondrocytes protein 2) (mDEC2)	EBI-6146266	0.00
P43243	Matrin-3	EBI-10325772	0.72
P61978	Heterogeneous nuclear ribonucleoprotein K (hnRNP K) (Transformation up-regulated nuclear protein) (TUNP)	EBI-10325782	0.56
Q15415	RNA-binding motif protein, Y chromosome, family 1 member F/J (Y chromosome RNA recognition motif 2)	EBI-10325792	0.72
P06428	Protein E6	EBI-11738005	0.37
P60411	Keratin-associated protein 10-9 (High sulfur keratin-associated protein 10.9) (Keratin-associated protein 10.9) (Keratin-associated protein 18-9) (Keratin-associated protein 18.9)	EBI-24275367	0.56
Q13064	Probable E3 ubiquitin-protein ligase makorin-3 (EC 2.3.2.27) (RING finger protein 63) (RING-type E3 ubiquitin transferase makorin-3) (Zinc finger protein 127)	EBI-24303758	0.56
Q96B26	Exosome complex component RRP43 (Exosome component 8) (Opa-interacting protein 2) (OIP-2) (Ribosomal RNA-processing protein 43) (p9)	EBI-24304269	0.56
Q86X02	Cerebellar degeneration-related protein 2-like (Paraneoplastic 62 kDa antigen)	EBI-24306796	0.56
O43390	Heterogeneous nuclear ribonucleoprotein R (hnRNP R)	EBI-24346887	0.56
P0DPK4	Notch homolog 2 N-terminal-like protein C	EBI-24358097	0.56
Q8IUG1	Keratin-associated protein 1-3 (Keratin-associated protein 1.8) (Keratin-associated protein 1.9)	EBI-24360657	0.56
Q86YV0	RAS protein activator like-3	EBI-25246276	0.56
Q9NYB9	Abl interactor 2 (Abelson interactor 2) (Abi-2) (Abl-binding protein 3) (AblBP3) (Arg-binding protein 1) (ArgBP1)	EBI-25258493	0.56
A8MQ03	Cysteine-rich tail protein 1	EBI-25259175	0.56
Q2TAC2	Coiled-coil domain-containing protein 57	EBI-24365172	0.56
P0DJD3	RNA-binding motif protein, Y chromosome, family 1 member A1 (RNA-binding motif protein 1) (RNA-binding motif protein 2) (Y chromosome RNA recognition motif 1) (hRBMY)	EBI-24491672	0.56
Q16825	Tyrosine-protein phosphatase non-receptor type 21 (EC 3.1.3.48) (Protein-tyrosine phosphatase D1)	EBI-24501862	0.56
Q99750	MyoD family inhibitor (Myogenic repressor I-mf)	EBI-24401121	0.56
O00308	NEDD4-like E3 ubiquitin-protein ligase WWP2 (EC 2.3.2.26) (Atrophin-1-interacting protein 2) (AIP2) (HECT-type E3 ubiquitin transferase WWP2) (WW domain-containing protein 2)	EBI-24369877	0.56
P26371	Keratin-associated protein 5-9 (Keratin, cuticle, ultrahigh sulfur 1) (Keratin, ultra high-sulfur matrix protein A) (Keratin-associated protein 5.9) (UHS keratin A) (UHS KerA) (Ultrahigh sulfur keratin-associated protein 5.9)	EBI-24396272	0.56
O75525	KH domain-containing, RNA-binding, signal transduction-associated protein 3 (RNA-binding protein T-Star) (Sam68-like mammalian protein 2) (SLM-2) (Sam68-like phosphotyrosine protein)	EBI-24402473	0.56
Q5JR59	Microtubule-associated tumor suppressor candidate 2 (Cardiac zipper protein) (Microtubule plus-end tracking protein TIP150) (Tracking protein of 150 kDa)	EBI-24456980	0.56
O76011	Keratin, type I cuticular Ha4 (Hair keratin, type I Ha4) (Keratin-34) (K34)	EBI-24457300	0.56
P60410	Keratin-associated protein 10-8 (High sulfur keratin-associated protein 10.8) (Keratin-associated protein 10.8) (Keratin-associated protein 18-8) (Keratin-associated protein 18.8)	EBI-24473269	0.56
Q3LI66	Keratin-associated protein 6-2	EBI-24576504	0.56
Q9NQX1	PR domain zinc finger protein 5 (EC 2.1.1.-) (PR domain-containing protein 5)	EBI-24598415	0.56
Q6PEX3	Keratin-associated protein 26-1	EBI-24638857	0.56
P05067	Amyloid-beta precursor protein (APP) (ABPP) (APPI) (Alzheimer disease amyloid A4 protein homolog) (Alzheimer disease amyloid protein) (Amyloid precursor protein) (Amyloid-beta (A4) precursor protein) (Amyloid-beta A4 protein) (Cerebral vascular amyloid peptide) (CVAP) (PreA4) (Protease nexin-II) (PN-II) [Cleaved into: N-APP; Soluble APP-alpha (S-APP-alpha); Soluble APP-beta (S-APP-beta); C99 (Beta-secretase C-terminal fragment) (Beta-CTF); Amyloid-beta protein 42 (Abeta42) (Beta-APP42); Amyloid-beta protein 40 (Abeta40) (Beta-APP40); C83 (Alpha-secretase C-terminal fragment) (Alpha-CTF); P3(42); P3(40); C80; Gamma-secretase C-terminal fragment 59 (Amyloid intracellular domain 59) (AICD-59) (AID(59)) (Gamma-CTF(59)); Gamma-secretase C-terminal fragment 57 (Amyloid intracellular domain 57) (AICD-57) (AID(57)) (Gamma-CTF(57)); Gamma-secretase C-terminal fragment 50 (Amyloid intracellular domain 50) (AICD-50) (AID(50)) (Gamma-CTF(50)); C31]	EBI-25939746	0.56

Cross-References

Database	Links
UNIPROT	Q9Y272 B2R709 B4DFF4 Q9NYB4
Pfam	PF00071
PROSITE	PS51421
OMIM	605550
DisGeNET	51655

Dexamethasone-induced Ras-related protein 1 (Homo sapiens)

General Information

Protein Information

Subcellular Location

Description Show

Position in the Nuclear Envelope

Membrane Topology

Assigned Ontology terms

Biology & Function

Description Hide

Assigned Ontology terms

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (2 interactors)

Interactions with other proteins (30 interactors)

Cross-References

Database

Links

Description

Description