Myotubularin-related protein 9 - Homo sapiens

Myotubularin-related protein 9 (Homo sapiens)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	Myotubularin-related protein 9
Accession Code	Q96QG7
Gene	MTMR9
Organism	Homo sapiens \| Human (Taxonomy: 9606)
Part of Reference Proteome?	Yes
Sequence (Length: 549)
MEFAELIKTPRVDNVVLHRPFYPAVEGTLCLTGHHLILSSRQDNTEELWLLHSNIDAIDKRFVGSLGTIIIKCKDFRIIQLDIPGMEECLNIASSIEALSTLDSITLMYPFFYRPMFEVIEDGWHSFLPE QEFELYSSATSEWRLSYVNKEFAVCPSYPPIVTVPKSIDDEALRKVATFRHGGRFPVLSYYHKKNGMVIMRSGQPLTGTNGRRCKEDEKLINATLRAGKRGYIIDTRSLNVAQQTRAKGGGFEQEAHYPQ WRRIHKSIERYHILQESLIKLVEACNDQTHNMDRWLSKLEASNWLTHIKEILTTACLAAQCIDREGASILIHGTEGTDSTLQVTSLAQIILEPRSRTIRGFEALIEREWLQAGHPFQQRCAQSAYCNTKQ KWEAPVFLLFLDCVWQILRQFPCSFEFNENFLIMLFEHAYASQFGTFLGNNESERCKLKLQQKTMSLWSWVNQPSELSKFTNPLFEANNLVIWPSVAPQSLPLWEGIFLRWNRSSKYLDEAYEEMVNIIE YNKELQAKVNILRRQLAELETEDGMQESP

Subcellular Location

Description
Cytoplasm {Experimental EvidencePubMed:16787938, Experimental EvidencePubMed:19038970}. Cell projection, ruffle membrane {By SimilarityUniProtKB:Q9Z2D0}; Peripheral membrane protein {Curator Inference}; Cytoplasmic side {Curator Inference}. Cytoplasm, perinuclear region {Experimental EvidencePubMed:16787938, Experimental EvidencePubMed:19038970}. Endoplasmic reticulum {Experimental EvidencePubMed:19038970}. Note=Localizes to ruffles during EGF-induced macropinocytosis (By similarity). Colocalizes with MTMR6 to the perinuclear region (PubMed:19038970). Partially localizes to the endoplasmic reticulum (PubMed:19038970). {By SimilarityUniProtKB:Q9Z2D0, Experimental EvidencePubMed:19038970}.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Peripheral	UniProt	Curator Inference {ECO:0000305}
Assigned Ontology terms

Cellular Component	Cytoplasm (GO:0005737) Cytosol (GO:0005829) Endoplasmic Reticulum (GO:0005783) Perinuclear Region Of Cytoplasm (GO:0048471) Protein-Containing Complex (GO:0032991) Ruffle Membrane (GO:0032587)

Biology & Function

Description
Acts as an adapter for myotubularin-related phosphatases (PubMed:19038970, PubMed:22647598). Increases lipid phosphatase MTMR6 catalytic activity, specifically towards phosphatidylinositol 3,5- bisphosphate and MTMR6 binding affinity for phosphorylated phosphatidylinositols (PubMed:19038970, PubMed:22647598). Positively regulates lipid phosphatase MTMR7 catalytic activity (By similarity). Increases MTMR8 catalytic activity towards phosphatidylinositol 3- phosphate (PubMed:22647598). The formation of the MTMR6-MTMR9 complex, stabilizes both MTMR6 and MTMR9 protein levels (PubMed:19038970). Stabilizes MTMR8 protein levels (PubMed:22647598). Plays a role in the late stages of macropinocytosis possibly by regulating MTMR6-mediated dephosphorylation of phosphatidylinositol 3-phosphate in membrane ruffles (PubMed:24591580). Negatively regulates autophagy, in part via its association with MTMR8 (PubMed:22647598). Negatively regulates DNA damage-induced apoptosis, in part via its association with MTMR6 (PubMed:19038970, PubMed:22647598). Does not bind mono-, di- and tri- phosphorylated phosphatidylinositols, phosphatidic acid and phosphatidylserine (PubMed:19038970). {By SimilarityUniProtKB:Q9Z2D0, Experimental EvidencePubMed:19038970, Experimental EvidencePubMed:22647598, Experimental EvidencePubMed:24591580}.
Assigned Ontology terms

Biological Process	Endocytosis (GO:0006897) Negative Regulation Of Autophagy (GO:0010507) Phosphatidylinositol Dephosphorylation (GO:0046856) Positive Regulation Of Phosphatase Activity (GO:0010922) Protein Stabilization (GO:0050821) Regulation Of Phosphatidylinositol Dephosphorylation (GO:0060304)
Molecular Function	Enzyme Regulator Activity (GO:0030234) Phosphatidylinositol-3-Phosphate Phosphatase Activity (GO:0004438) Protein Phosphatase Binding (GO:0019903)

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (9 interactors)

Partner (NucEnvDB)		IntAct	Confidence score
Q96QG7	Self	EBI-755452	0.55
P10909	Clusterin alpha chain	EBI-21831285	0.35
O75140	GATOR complex protein DEPDC5	EBI-24656502	0.56
P00533	Epidermal growth factor receptor	EBI-32720286	0.27
Q9Y6X4	Soluble lamin-associated protein of 75 kDa	EBI-24348015	0.56
Q6ZMQ8	Serine/threonine-protein kinase LMTK1	EBI-20980306	0.37
Q13614	Myotubularin-related protein 2	EBI-27113664	0.35
Q9Y217	Myotubularin-related protein 6	EBI-8657967	0.85
Q96EF0	Myotubularin-related protein 8	EBI-758404	0.81
Interactions with other proteins (34 interactors)

Partner (UniProt)		IntAct	Confidence score
Q9Y6C2	EMILIN-1 (Elastin microfibril interface-located protein 1) (Elastin microfibril interfacer 1)	EBI-754120	0.88
Q9NZD8	Maspardin (Acid cluster protein 33) (Spastic paraplegia 21 autosomal recessive Mast syndrome protein) (Spastic paraplegia 21 protein)	EBI-756217	0.37
Q01844	RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein)	EBI-759352	0.37
Q13618	Cullin-3 (CUL-3)	EBI-21329068	0.35
O60341	Lysine-specific histone demethylase 1A (EC 1.14.99.66) (BRAF35-HDAC complex protein BHC110) (Flavin-containing amine oxidase domain-containing protein 2) ([histone H3]-dimethyl-L-lysine(4) FAD-dependent demethylase 1A)	EBI-8476194	0.37
P00540	Proto-oncogene serine/threonine-protein kinase mos (EC 2.7.11.1) (Oocyte maturation factor mos) (Proto-oncogene c-Mos)	EBI-10193386	0.74
Q08AM6	Protein VAC14 homolog (Tax1-binding protein 2)	EBI-10292953	0.56
Q13287	N-myc-interactor (Nmi) (N-myc and STAT interactor)	EBI-10292965	0.72
Q8TBB1	E3 ubiquitin-protein ligase LNX (EC 2.3.2.27) (Ligand of Numb-protein X 1) (Numb-binding protein 1) (PDZ domain-containing RING finger protein 2) (RING-type E3 ubiquitin transferase LNX)	EBI-10292977	0.74
Q9Y216	Myotubularin-related protein 7 (Inositol 1,3-bisphosphate phosphatase) (EC 3.1.3.-) (Phosphatidylinositol-3-phosphate phosphatase) (EC 3.1.3.64)	EBI-10293001	0.90
Q6P5F9	Exportin-1 (Exp1) (Chromosome region maintenance 1 protein homolog)	EBI-11603310	0.35
P26045	Tyrosine-protein phosphatase non-receptor type 3 (EC 3.1.3.48) (Protein-tyrosine phosphatase H1) (PTP-H1)	EBI-24295537	0.56
Q7Z3Y8	Keratin, type I cytoskeletal 27 (Cytokeratin-27) (CK-27) (Keratin-25C) (K25C) (Keratin-27) (K27) (Type I inner root sheath-specific keratin-K25irs3)	EBI-24327528	0.56
Q7Z6G3	N-terminal EF-hand calcium-binding protein 2 (EF-hand calcium-binding protein 2) (Neuronal calcium-binding protein 2) (Synaptotagmin-interacting protein 2) (Stip-2)	EBI-24331912	0.56
Q6IC98	GRAM domain-containing protein 4 (Death-inducing protein)	EBI-24604921	0.56
Q0VD86	Protein INCA1 (Inhibitor of CDK interacting with cyclin A1)	EBI-24695190	0.56
Q8N720	Zinc finger protein 655 (Vav-interacting Krueppel-like protein)	EBI-24727726	0.56
A8MW99	Meiosis-specific protein MEI4	EBI-23821907	0.56
Q86T90	Protein hinderin	EBI-24423707	0.56
Q8N5Z5	BTB/POZ domain-containing protein KCTD17	EBI-21592259	0.35
P32320	Cytidine deaminase (EC 3.5.4.5) (Cytidine aminohydrolase)	EBI-21622979	0.35
P14091	Cathepsin E (EC 3.4.23.34) [Cleaved into: Cathepsin E form I; Cathepsin E form II]	EBI-21699601	0.35
P05090	Apolipoprotein D (Apo-D) (ApoD)	EBI-21831285	0.35
Q15303	Receptor tyrosine-protein kinase erbB-4 (EC 2.7.10.1) (Proto-oncogene-like protein c-ErbB-4) (Tyrosine kinase-type cell surface receptor HER4) (p180erbB4) [Cleaved into: ERBB4 intracellular domain (4ICD) (E4ICD) (s80HER4)]	EBI-20980466	0.37
P21860	Receptor tyrosine-protein kinase erbB-3 (EC 2.7.10.1) (Proto-oncogene-like protein c-ErbB-3) (Tyrosine kinase-type cell surface receptor HER3)	EBI-20981046	0.37
Q01974	Tyrosine-protein kinase transmembrane receptor ROR2 (EC 2.7.10.1) (Neurotrophic tyrosine kinase, receptor-related 2)	EBI-20981830	0.37
Q13308	Inactive tyrosine-protein kinase 7 (Colon carcinoma kinase 4) (CCK-4) (Protein-tyrosine kinase 7) (Pseudo tyrosine kinase receptor 7) (Tyrosine-protein kinase-like 7)	EBI-20982474	0.37
O43464	Serine protease HTRA2, mitochondrial (EC 3.4.21.108) (High temperature requirement protein A2) (HtrA2) (Omi stress-regulated endoprotease) (Serine protease 25) (Serine proteinase OMI)	EBI-27050249	0.35
Q96LU5	Mitochondrial inner membrane protease subunit 1 (EC 3.4.21.-) (IMP1-like protein)	EBI-27050332	0.35
Q96T52	Mitochondrial inner membrane protease subunit 2 (EC 3.4.21.-) (IMP2-like protein)	EBI-27050444	0.35
P15924	Desmoplakin (DP) (250/210 kDa paraneoplastic pemphigus antigen)	EBI-27113664	0.35
Q9UII2	ATPase inhibitor, mitochondrial (ATP synthase F1 subunit epsilon) (Inhibitor of F(1)F(o)-ATPase) (IF(1)) (IF1)	EBI-27113664	0.35
P21802	Fibroblast growth factor receptor 2 (FGFR-2) (EC 2.7.10.1) (K-sam) (KGFR) (Keratinocyte growth factor receptor) (CD antigen CD332)	EBI-32721907	0.27
P22455	Fibroblast growth factor receptor 4 (FGFR-4) (EC 2.7.10.1) (CD antigen CD334)	EBI-32722168	0.27

Cross-References

Database	Links
UNIPROT	Q96QG7 B7Z291 Q52LU3 Q8WW11 Q96QG6 Q9NX50
Pfam	PF06602
PROSITE	PS51339
OMIM	606260
DisGeNET	66036

Myotubularin-related protein 9 (Homo sapiens)

General Information

Protein Information

Subcellular Location

Description Show

Position in the Nuclear Envelope

Membrane Topology

Assigned Ontology terms

Biology & Function

Description Hide

Assigned Ontology terms

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (9 interactors)

Interactions with other proteins (34 interactors)

Cross-References

Database

Links

Description

Description