Oxysterol-binding protein 1 - Homo sapiens

Oxysterol-binding protein 1 (Homo sapiens)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	Oxysterol-binding protein 1
Accession Code	P22059
Gene	OSBP
Organism	Homo sapiens \| Human (Taxonomy: 9606)
Part of Reference Proteome?	Yes
Sequence (Length: 807)
MAATELRGVVGPGPAAIAALGGGGAGPPVVGGGGGRGDAGPGSGAASGTVVAAAAGGPGPGAGGVAAAGPAPAPPTGGSG GSGAGGSGSAREGWLFKWTNYIKGYQRRWFVLSNGLLSYYRSKAEMRHTCRGTINLATANITVEDSCNFIISNGGAQTYH LKASSEVERQRWVTALELAKAKAVKMLAESDESGDEESVSQTDKTELQNTLRTLSSKVEDLSTCNDLIAKHGTALQRSLS ELESLKLPAESNEKIKQVNERATLFRITSNAMINACRDFLMLAQTHSKKWQKSLQYERDQRIRLEETLEQLAKQHNHLER AFRGATVLPANTPGNVGSGKDQCCSGKGDMSDEDDENEFFDAPEIITMPENLGHKRTGSNISGASSDISLDEQYKHQLEE TKKEKRTRIPYKPNYSLNLWSIMKNCIGKELSKIPMPVNFNEPLSMLQRLTEDLEYHELLDRAAKCENSLEQLCYVAAFT VSSYSTTVFRTSKPFNPLLGETFELDRLEENGYRSLCEQVSHHPPAAAHHAESKNGWTLRQEIKITSKFRGKYLSIMPLG TIHCIFHATGHHYTWKKVTTTVHNIIVGKLWIDQSGEIDIVNHKTGDKCNLKFVPYSYFSRDVARKVTGEVTDPSGKVHF ALLGTWDEKMECFKVQPVIGENGGDARQRGHEAEESRVMLWKRNPLPKNAENMYYFSELALTLNAWESGTAPTDSRLRPD QRLMENGRWDEANAEKQRLEEKQRLSRKKREAEAMKATEDGTPYDPYKALWFERKKDPVTKELTHIYRGEYWECKEKQDW SSCPDIF

Structure Viewer (PDB: 2RR3)

Subcellular Location

Description
Cytoplasm, cytosol {Experimental EvidencePubMed:24209621, Experimental EvidencePubMed:29514919}. Cytoplasm, perinuclear region {Experimental EvidencePubMed:24209621}. Golgi apparatus membrane; Peripheral membrane protein {Experimental EvidencePubMed:24209621}. Endoplasmic reticulum membrane; Peripheral membrane protein {Experimental EvidencePubMed:24209621}. Golgi apparatus, trans-Golgi network {Experimental EvidencePubMed:29514919}. Note=Predominantly cytosolic. {Experimental EvidencePubMed:24209621}.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Peripheral	UniProt	Experimental Evidence {ECO:0000269\|PubMed:24209621}
Assigned Ontology terms

Cellular Component	Cell Junction (GO:0030054) Cytoplasm (GO:0005737) Cytosol (GO:0005829) Endoplasmic Reticulum Membrane (GO:0005789) Golgi Apparatus (GO:0005794) Golgi Membrane (GO:0000139) Intracellular Membrane-Bounded Organelle (GO:0043231) Membrane (GO:0016020) Nucleolus (GO:0005730) Nucleoplasm (GO:0005654) Perinuclear Endoplasmic Reticulum (GO:0097038) Perinuclear Region Of Cytoplasm (GO:0048471) Plasma Membrane (GO:0005886) Trans-Golgi Network (GO:0005802)

Biology & Function

Description
Lipid transporter involved in lipid countertransport between the Golgi complex and membranes of the endoplasmic reticulum: specifically exchanges sterol with phosphatidylinositol 4-phosphate (PI4P), delivering sterol to the Golgi in exchange for PI4P, which is degraded by the SAC1/SACM1L phosphatase in the endoplasmic reticulum (PubMed:24209621). Binds cholesterol and a range of oxysterols including 25-hydroxycholesterol (PubMed:15746430, PubMed:17428193). Cholesterol binding promotes the formation of a complex with PP2A and a tyrosine phosphatase which dephosphorylates ERK1/2, whereas 25- hydroxycholesterol causes its disassembly (PubMed:15746430). Regulates cholesterol efflux by decreasing ABCA1 stability (PubMed:18450749). {Experimental EvidencePubMed:15746430, Experimental EvidencePubMed:17428193, Experimental EvidencePubMed:18450749, Experimental EvidencePubMed:24209621}.
Assigned Ontology terms

Biological Process	Bile Acid Biosynthetic Process (GO:0006699) Ceramide Transport (GO:0035627) Intracellular Cholesterol Transport (GO:0032367) Phospholipid Transport (GO:0015914) Positive Regulation Of Insulin Secretion Involved In Cellular Response To Glucose Stimulus (GO:0035774) Positive Regulation Of Secretory Granule Organization (GO:1904411) Positive Regulation Of Tyrosine Phosphorylation Of STAT Protein (GO:0042531) Sphingomyelin Biosynthetic Process (GO:0006686) Sterol Transport (GO:0015918)
Molecular Function	Oxysterol Binding (GO:0008142) Phosphatidylinositol-4-Phosphate Binding (GO:0070273) Protein Domain Specific Binding (GO:0019904) Sterol Binding (GO:0032934) Sterol Transfer Activity (GO:0120015) Sterol Transporter Activity (GO:0015248)

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (1 interactors)

Partner (NucEnvDB)		IntAct	Confidence score
Q9P0L0	Vesicle-associated membrane protein-associated protein A	EBI-11120309	0.74
Interactions with other proteins (25 interactors)

Partner (UniProt)		IntAct	Confidence score
P08047	Transcription factor Sp1	EBI-2681899	0.00
P68400	Casein kinase II subunit alpha (CK II alpha) (EC 2.7.11.1)	EBI-5321687	0.44
O75344	Inactive peptidyl-prolyl cis-trans isomerase FKBP6 (Inactive PPIase FKBP6) (36 kDa FK506-binding protein) (36 kDa FKBP) (FKBP-36) (FK506-binding protein 6) (FKBP-6) (Immunophilin FKBP36)	EBI-9364555	0.62
A0A0H3NDL6	Type III secretion system effector protein, deubiquitinase	EBI-10690222	0.52
Q8ZNG2	Deubiquitinase SseL (EC 3.4.22.-) (Deubiquitinating enzyme) (DUB) (Deubiquitinating protease) (Salmonella secreted effector L)	EBI-10710869	0.52
Q86X19	Transmembrane protein 17	EBI-11372615	0.27
Q9P0N5	Transmembrane protein 216	EBI-11378021	0.27
Q86UE6	Leucine-rich repeat transmembrane neuronal protein 1	EBI-21507777	0.35
Q6UX41	Butyrophilin-like protein 8	EBI-21529766	0.35
Q7KYR7	Butyrophilin subfamily 2 member A1	EBI-21541130	0.35
O95292	Vesicle-associated membrane protein-associated protein B/C (VAMP-B/VAMP-C) (VAMP-associated protein B/C) (VAP-B/VAP-C)	EBI-21550215	0.35
Q8WWF5	E3 ubiquitin-protein ligase ZNRF4 (EC 2.3.2.27) (Nixin) (RING finger protein 204) (RING-type E3 ubiquitin transferase ZNRF4) (Zinc/RING finger protein 4)	EBI-21589535	0.35
Q9NRJ7	Protocadherin beta-16 (PCDH-beta-16) (Protocadherin-3X)	EBI-21590428	0.35
P33151	Cadherin-5 (7B4 antigen) (Vascular endothelial cadherin) (VE-cadherin) (CD antigen CD144)	EBI-21650356	0.35
Q9Y5G8	Protocadherin gamma-A5 (PCDH-gamma-A5)	EBI-21697051	0.35
P05120	Plasminogen activator inhibitor 2 (PAI-2) (Monocyte Arg-serpin) (Placental plasminogen activator inhibitor) (Serpin B2) (Urokinase inhibitor)	EBI-21713063	0.35
Q96FV0	Leucine-rich repeat-containing protein 46	EBI-21840089	0.35
P61769	Beta-2-microglobulin [Cleaved into: Beta-2-microglobulin form pI 5.3]	EBI-20911136	0.40
Q5S007	Leucine-rich repeat serine/threonine-protein kinase 2 (EC 2.7.11.1) (EC 3.6.5.-) (Dardarin)	EBI-21360986	0.35
Q92685	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase (EC 2.4.1.258) (Asparagine-linked glycosylation protein 3 homolog) (Dol-P-Man-dependent alpha(1-3)-mannosyltransferase) (Dolichyl-P-Man:Man(5)GlcNAc(2)-PP-dolichyl mannosyltransferase) (Dolichyl-phosphate-mannose--glycolipid alpha-mannosyltransferase) (Not56-like protein)	EBI-25468424	0.51
Q8NHP6	Motile sperm domain-containing protein 2	EBI-25617363	0.40
A0A0F6B423	Deubiquitinase	EBI-27033608	0.46
A0A0F6B1Q8	Secreted effector protein	EBI-27036840	0.46
Q8N488	RING1 and YY1-binding protein (Apoptin-associating protein 1) (APAP-1) (Death effector domain-associated factor) (DED-associated factor) (YY1 and E4TF1-associated factor 1)	EBI-27110926	0.35
Q16288	NT-3 growth factor receptor (EC 2.7.10.1) (GP145-TrkC) (Trk-C) (Neurotrophic tyrosine kinase receptor type 3) (TrkC tyrosine kinase)	EBI-32724526	0.27

Cross-References

Database	Links
UNIPROT	P22059 Q6P524
PDB	2RR3
Pfam	PF01237 PF00169
PROSITE	PS01013 PS50003
OMIM	167040
DisGeNET	5007

Oxysterol-binding protein 1 (Homo sapiens)

General Information

Protein Information

Structure Viewer (PDB: 2RR3)

Subcellular Location

Description Show

Position in the Nuclear Envelope

Membrane Topology

Assigned Ontology terms

Biology & Function

Description Hide

Assigned Ontology terms

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (1 interactors)

Interactions with other proteins (25 interactors)

Cross-References

Database

Links

Description

Description