Protein Information |
|
|---|---|
| Protein Name | Suppressor protein STM1 |
| Accession Code | P39015 |
| Gene | STM1 |
| Organism | Saccharomyces cerevisiae S288C (Taxonomy: 559292) |
| Part of Reference Proteome? | Yes |
| Sequence (Length: 273) | |
|
MSNPFDLLGNDVEDADVVVLPPKEIVKSNTSSKKADVPPPSADPSKARKNRPRPSGNEGAIRDKTAGRRNNRSKDVTDSA TTKKSNTRRATDRHSRTGKTDTKKKVNQGWGDDKKELSAEKEAQADAAAEIAEDAAEAEDAGKPKTAQLSLQDYLNQQAN NQFNKVPEAKKVELDAERIETAEKEAYVPATKVKNVKSKQLKTKEYLEFDATFVESNTRKNFGDRNNNSRNNFNNRRGGR GARKGNNTANATNSANTVQKNRNIDVSNLPSLA |
|
Structure Viewer (PDB: 5DC3) |
|---|
Description |
||
|---|---|---|
| Cytoplasm. Nucleus. Cytoplasm, perinuclear region. Note=Concentrated in the perinuclear region. | Position in the Nuclear Envelope |
|
| Location | Location ID | Description |
| Perinuclear Region | SL-0198 | The perinuclear region is the cytoplasmic region just around the nucleus. | Membrane Topology |
| Topology | Source | Annotation Type |
| Unknown | UniProt | Sequence Analysis | Assigned Ontology terms |
| Cellular Component | Cytoplasm (GO:0005737) Nucleus (GO:0005634) Perinuclear Region Of Cytoplasm (GO:0048471) Polysome (GO:0005844) |
|
Description |
|
|---|---|
| Binds specifically G4 quadruplex (these are four-stranded right-handed helices, stabilized by guanine base quartets) and purine motif triplex (characterized by a third, antiparallel purine-rich DNA strand located within the major groove of a homopurine stretch of duplex DNA) nucleic acid structures. These structures may be present at telomeres or in rRNAs. Acts with CDC13 to control telomere length homeostasis. Involved in the control of the apoptosis-like cell death. {Experimental EvidencePubMed:15044472}. | Assigned Ontology terms |
| Biological Process | Negative Regulation Of Apoptotic Process (GO:0043066) Regulation Of Translational Initiation In Response To Stress (GO:0043558) Telomere Maintenance (GO:0000723) TOR Signaling (GO:0031929) Translational Elongation (GO:0006414) |
| Molecular Function | DNA Binding (GO:0003677) Ribosome Binding (GO:0043022) Telomeric DNA Binding (GO:0042162) Triplex DNA Binding (GO:0045142) |
Interactions with Nuclear Envelope proteins (5 interactors) |
|||
|---|---|---|---|
| Partner (NucEnvDB) | IntAct | Confidence score | |
| P22147 | 5'-3' exoribonuclease 1 | EBI-7383874 | 0.40 |
| P30822 | Exportin-1 | EBI-11611503 | 0.35 |
| P39015 | Self | EBI-7102530 | 0.40 |
| P06704 | Cell division control protein 31 | EBI-7945762 | 0.40 |
| P40318 | ERAD-associated E3 ubiquitin-protein ligase DOA10 | EBI-939185 | 0.44 | Interactions with other proteins (110 interactors) |
| Partner (UniProt) | IntAct | Confidence score | |
| P40968 | Pre-mRNA-processing factor 17 (Cell division control protein 40) | EBI-7102563 | 0.40 |
| P10863 | Cold shock-induced protein TIR1 (Serine-rich protein 1) (TIP1-related protein 1) | EBI-7109009 | 0.40 |
| Q12114 | Chitin biosynthesis protein CHS5 (Protein CAL3) | EBI-784698 | 0.35 |
| P38968 | Protein transport protein SEC31 (Protein WEB1) | EBI-788839 | 0.35 |
| P38199 | Heterogeneous nuclear rnp K-like protein 2 (KH domain-containing protein 1) | EBI-796822 | 0.35 |
| P07280 | 40S ribosomal protein S19-A (RP55A) (S16a) (Small ribosomal subunit protein eS19-A) (YP45) (YS16A) | EBI-801098 | 0.35 |
| P32790 | Actin cytoskeleton-regulatory complex protein SLA1 | EBI-802790 | 0.35 |
| Q08687 | Translation machinery-associated protein 16 | EBI-807945 | 0.35 |
| P11632 | Non-histone chromosomal protein 6A | EBI-808830 | 0.35 |
| P38700 | Adaptin medium chain homolog APM2 (Adaptin-mu1-II) | EBI-813960 | 0.27 |
| P38822 | Protein BZZ1 (LAS17-binding protein 7) | EBI-815028 | 0.27 |
| P32357 | A1 cistron-splicing factor AAR2 | EBI-817406 | 0.27 |
| P38285 | Antagonist of mitotic exit network protein 1 (Chromosome stability protein 13) (Increased copper-sensitivity protein 4) | EBI-818288 | 0.27 |
| P40522 | Transcription factor VHR1 (VHT1 regulator 1) | EBI-819618 | 0.27 |
| Q12389 | ATP-dependent RNA helicase DBP10 (EC 3.6.4.13) (DEAD box protein 10) | EBI-819624 | 0.27 |
| P00330 | Alcohol dehydrogenase 1 (EC 1.1.1.1) (Alcohol dehydrogenase I) (YADH-1) | EBI-819848 | 0.27 |
| Q02486 | ARS-binding factor 2, mitochondrial | EBI-820332 | 0.27 |
| P02293 | Histone H2B.1 (Suppressor of Ty protein 12) | EBI-820511 | 0.27 |
| P07270 | Phosphate system positive regulatory protein PHO4 | EBI-821981 | 0.35 |
| P22082 | Transcription regulatory protein SNF2 (EC 3.6.4.-) (ATP-dependent helicase SNF2) (Regulatory protein GAM1) (Regulatory protein SWI2) (SWI/SNF complex component SNF2) (Transcription factor TYE3) | EBI-822228 | 0.35 |
| P39940 | E3 ubiquitin-protein ligase RSP5 (EC 2.3.2.26) (HECT-type E3 ubiquitin transferase RSP5) (Reverses SPT-phenotype protein 5) | EBI-937964 | 0.44 |
| P43582 | WW domain-containing protein WWM1 (WW domain-containing protein interacting with metacaspase) | EBI-938833 | 0.44 |
| P46995 | Histone-lysine N-methyltransferase, H3 lysine-36 specific (EC 2.1.1.359) (Lysine N-methyltransferase 3) (SET domain-containing protein 2) | EBI-939475 | 0.44 |
| P22696 | Peptidyl-prolyl cis-trans isomerase ESS1 (PPIase ESS1) (EC 5.2.1.8) (Parvulin ESS1) (Processing/termination factor 1) | EBI-939677 | 0.44 |
| P33203 | Pre-mRNA-processing protein PRP40 | EBI-940012 | 0.44 |
| Q06525 | Pre-mRNA-splicing factor URN1 (U2-U5-U6 snRNP, RES complex and NTC-interacting pre-mRNA-splicing factor 1) | EBI-940637 | 0.44 |
| P38633 | Mediator of RNA polymerase II transcription subunit 31 (Hpr1 suppressor protein 1) (Mediator complex subunit 31) | EBI-7030235 | 0.40 |
| P32558 | FACT complex subunit SPT16 (Cell division control protein 68) (Facilitates chromatin transcription complex subunit SPT16) (Suppressor of Ty protein 16) | EBI-7033179 | 0.40 |
| P42945 | U3 small nucleolar RNA-associated protein 10 (U3 snoRNA-associated protein 10) (U three protein 10) (U3 protein 10 required for transcription) (t-UTP10) | EBI-7118959 | 0.40 |
| Q06188 | PWWP domain-containing protein YLR455W | EBI-7172803 | 0.40 |
| Q06109 | Required for respiratory growth protein 8, mitochondrial | EBI-7201165 | 0.40 |
| P53741 | UBP3-associated protein BRE5 (Brefeldin-A sensitivity protein 5) | EBI-7226242 | 0.56 |
| P40023 | Enhancer of mRNA-decapping protein 2 | EBI-7284277 | 0.40 |
| P20448 | ATP-dependent RNA helicase HCA4 (EC 3.6.4.13) (DEAD box protein 4) (Helicase CA4) (Helicase UF1) | EBI-7328235 | 0.40 |
| P48570 | Homocitrate synthase, cytosolic isozyme (HCS) (EC 2.3.3.14) | EBI-7405961 | 0.40 |
| P32505 | Nuclear polyadenylated RNA-binding protein NAB2 | EBI-7425228 | 0.40 |
| P38205 | Multisite-specific tRNA:(cytosine-C(5))-methyltransferase (EC 2.1.1.202) (Multisite-specific tRNA:m5C-methyltransferase) (tRNA (cytosine-5-)-methyltransferase NCL1) (tRNA methyltransferase 4) | EBI-7427415 | 0.40 |
| P39744 | Nucleolar complex protein 2 | EBI-7430572 | 0.40 |
| P53742 | Nucleolar GTP-binding protein 2 | EBI-7433745 | 0.40 |
| P21951 | DNA polymerase epsilon catalytic subunit A (EC 2.7.7.7) (3'-5' exodeoxyribonuclease) (EC 3.1.11.-) (DNA polymerase II subunit A) | EBI-7459287 | 0.40 |
| Q07350 | Pre-mRNA-splicing factor PRP11 | EBI-7554433 | 0.40 |
| P53131 | Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP43 (EC 3.6.4.13) (Helicase JA1) | EBI-7558289 | 0.40 |
| P31374 | Serine/threonine-protein kinase PSK1 (EC 2.7.11.1) (PAS kinase 1) | EBI-7560747 | 0.40 |
| Q04373 | Pumilio homology domain family member 6 | EBI-7563094 | 0.40 |
| P38251 | Replication factor C subunit 5 (Replication factor C5) (Activator 1 40 kDa subunit) | EBI-7577892 | 0.40 |
| Q03195 | Translation initiation factor RLI1 (ATP-binding cassette sub-family E member RLI1) (RNase L inhibitor) | EBI-7580304 | 0.40 |
| P25046 | Mediator of RNA polymerase II transcription subunit 19 (Hypoxic gene repressor protein 3) (Mediator complex subunit 19) (Negative regulator of URS2 protein 3) (SNF1 suppressor protein 7) | EBI-7583439 | 0.40 |
| P0C0T4 | 40S ribosomal protein S25-B (RP45) (S31) (Small ribosomal subunit protein eS25-B) (YS23) | EBI-7651776 | 0.40 |
| P47050 | Cullin-8 (Cullin-C) (Regulator of Ty1 transposition protein 101) | EBI-7664713 | 0.40 |
| P32368 | Phosphatidylinositol-3-phosphatase SAC1 (EC 3.1.3.64) (Phosphatidylinositol-4-phosphate phosphatase) (Recessive suppressor of secretory defect) | EBI-7668370 | 0.40 |
| P40509 | Coatomer subunit epsilon (Epsilon-coat protein) (Epsilon-COP) | EBI-7677023 | 0.40 |
| P23293 | Serine/threonine-protein kinase BUR1 (EC 2.7.11.22) (EC 2.7.11.23) (Bypass UAS requirement protein 1) (Suppressor of GPA1-Vall50 mutation protein 1) | EBI-7692513 | 0.40 |
| P22579 | Transcriptional regulatory protein SIN3 | EBI-7697200 | 0.40 |
| P35207 | Antiviral helicase SKI2 (EC 3.6.4.13) (Superkiller protein 2) | EBI-7700401 | 0.40 |
| Q02793 | Antiviral protein SKI8 (Superkiller protein 8) | EBI-7701654 | 0.40 |
| P40072 | E3 ubiquitin-protein ligase complex SLX5-SLX8 subunit SLX8 (EC 2.3.2.27) (RING-type E3 ubiquitin transferase SLX8) (Synthetic lethal of unknown function protein 8) | EBI-7703803 | 0.40 |
| P46965 | Signal peptidase complex subunit 1 (Microsomal signal peptidase subunit 1) | EBI-7734821 | 0.40 |
| P38123 | COMPASS component SWD3 (Complex proteins associated with SET1 protein SWD3) (Set1C component SWD3) | EBI-7768968 | 0.40 |
| P36100 | Transcription initiation factor IIE subunit alpha (TFIIE-alpha) (Factor A 66 kDa subunit) (Transcription factor A large subunit) | EBI-7777929 | 0.40 |
| Q07381 | Ribosome biogenesis protein TSR1 (20S rRNA accumulation protein 1) | EBI-7786590 | 0.40 |
| Q06672 | Pre-rRNA-processing protein TSR2 (20S rRNA accumulation protein 2) | EBI-7787631 | 0.40 |
| P53874 | Ubiquitin carboxyl-terminal hydrolase 10 (EC 3.4.19.12) (Deubiquitinating enzyme 10) (Disrupter of telomere silencing protein 4) (Ubiquitin thioesterase 10) (Ubiquitin-specific-processing protease 10) | EBI-7789499 | 0.40 |
| Q01477 | Ubiquitin carboxyl-terminal hydrolase 3 (EC 3.4.19.12) (Deubiquitinating enzyme 3) (Ubiquitin thioesterase 3) (Ubiquitin-specific-processing protease 3) | EBI-7792626 | 0.56 |
| P53254 | U3 small nucleolar RNA-associated protein 22 (U3 snoRNA-associated protein 22) (U three protein 22) | EBI-7813272 | 0.40 |
| Q08831 | RNA-binding protein VTS1 (VTI1-2 suppressor protein 1) | EBI-7831006 | 0.40 |
| P38197 | Pyridoxal phosphate homeostasis protein (PLP homeostasis protein) | EBI-7834574 | 0.40 |
| P40487 | 2-(3-amino-3-carboxypropyl)histidine synthase subunit 1 (EC 2.5.1.108) (Diphthamide biosynthesis protein 1) (Diphtheria toxin resistance protein 1) (S-adenosyl-L-methionine:L-histidine 3-amino-3-carboxypropyltransferase 1) | EBI-7858467 | 0.40 |
| P40462 | Protein TMA108 (EC 3.4.11.-) (108 kDa translation machinery-associated protein) | EBI-7859020 | 0.40 |
| Q07953 | Ribosome maturation protein SDO1 | EBI-7861598 | 0.40 |
| Q3E747 | Uncharacterized protein YLR363W-A | EBI-7862695 | 0.40 |
| P38806 | Chromatin modification-related protein YNG2 (ESA1-associated factor 4) (ING1 homolog 2) | EBI-7869465 | 0.40 |
| P53911 | Chromatin modification-related protein EAF7 (ESA1-associated factor 7) | EBI-7870828 | 0.40 |
| Q12080 | Ribosome biogenesis protein NOP53 (Nucleolar protein 53) | EBI-7884725 | 0.40 |
| Q12152 | Putative serine/threonine-protein kinase YPL150W (EC 2.7.11.1) | EBI-7884942 | 0.40 |
| Q12179 | Uncharacterized protein YPL245W | EBI-7885829 | 0.40 |
| P50275 | Anaphase spindle elongation protein | EBI-7913090 | 0.44 |
| Q04199 | Chromatin assembly factor 1 subunit p60 (CAF-1 60 kDa subunit) | EBI-7937753 | 0.40 |
| P38626 | NADH-cytochrome b5 reductase 1 (EC 1.6.2.2) (Microsomal cytochrome b reductase) (P35) | EBI-7943352 | 0.40 |
| Q06697 | Cell division control protein 73 (RNA polymerase-associated protein CDC73) | EBI-7949322 | 0.40 |
| P47130 | Cop9 signalosome complex subunit 12 | EBI-7983878 | 0.40 |
| Q02554 | Cold sensitive U2 snRNA suppressor 1 | EBI-7987846 | 0.40 |
| P18899 | Stress protein DDR48 (DNA damage-responsive protein 48) (DDRP 48) (Flocculent-specific protein) (YP 75) | EBI-7998863 | 0.40 |
| P24482 | DNA polymerase epsilon subunit B (DNA polymerase II subunit 2) | EBI-8000629 | 0.40 |
| P32803 | Endosomal protein P24B (24 kDa endomembrane protein) (Basic 24 kDa late endocytic intermediate component) | EBI-8005417 | 0.40 |
| P39704 | Protein ERP2 | EBI-8008355 | 0.40 |
| P15442 | eIF-2-alpha kinase GCN2 (EC 2.7.11.1) (General control non-derepressible protein 2) (Serine/threonine-protein kinase GCN2) | EBI-8014597 | 0.40 |
| Q04233 | Protein GIS4 | EBI-8017049 | 0.40 |
| P41911 | Glycerol-3-phosphate dehydrogenase [NAD(+)] 2, mitochondrial (EC 1.1.1.8) | EBI-8019433 | 0.40 |
| P32806 | GTPase-activating protein GYP6 (GAP for YPT6) | EBI-8020973 | 0.40 |
| Q12341 | Histone acetyltransferase type B catalytic subunit (EC 2.3.1.48) | EBI-8021985 | 0.40 |
| P53685 | NAD-dependent protein deacetylase HST1 (EC 2.3.1.286) (Homologous to SIR2 protein 1) (Regulatory protein SIR2 homolog 1) | EBI-8059242 | 0.40 |
| P38304 | Mediator of RNA polymerase II transcription subunit 8 (Mediator complex subunit 8) | EBI-8434332 | 0.40 |
| Q06164 | E3 ubiquitin-protein ligase substrate receptor MMS22 (Methyl methanesulfonate-sensitivity protein 22) (Synthetically lethal with MCM10 protein 2) | EBI-8437245 | 0.40 |
| P38694 | Putative aldehyde dehydrogenase-like protein YHR039C (EC 1.2.1.-) (Meiotic sister-chromatid recombination protein 7) | EBI-8443741 | 0.40 |
| P32495 | H/ACA ribonucleoprotein complex subunit NHP2 (H/ACA snoRNP protein NHP2) (High mobility group-like nuclear protein 2) | EBI-8449766 | 0.40 |
| Q07896 | Nucleolar complex-associated protein 3 | EBI-8452527 | 0.40 |
| P53927 | Ribosome biogenesis protein 15 (Nucleolar protein 15) | EBI-8453525 | 0.40 |
| P42841 | Polyadenylation factor subunit 2 | EBI-8486372 | 0.40 |
| P33775 | Dolichyl-phosphate-mannose--protein mannosyltransferase 1 (EC 2.4.1.109) | EBI-8494631 | 0.40 |
| P40454 | Serine/threonine-protein phosphatase 2A activator 1 (EC 5.2.1.8) (Peptidyl-prolyl cis-trans isomerase PTPA-1) (PPIase PTPA-1) (Rotamase PTPA-1) (Phosphotyrosyl phosphatase activator 1) | EBI-2886504 | 0.00 |
| P25294 | Protein SIS1 | EBI-3662273 | 0.35 |
| P10591 | Heat shock protein SSA1 (Heat shock protein YG100) | EBI-3678076 | 0.53 |
| P11484 | Ribosome-associated molecular chaperone SSB1 (EC 3.6.4.10) (Cold-inducible protein YG101) (Heat shock protein SSB1) (Hsp70 chaperone Ssb) | EBI-3784224 | 0.35 |
| P38788 | Ribosome-associated complex subunit SSZ1 (DnaK-related protein SSZ1) (Heat shock protein 70 homolog SSZ1) (Pleiotropic drug resistance protein 13) | EBI-3791884 | 0.35 |
| P40150 | Ribosome-associated molecular chaperone SSB2 (EC 3.6.4.10) (Heat shock protein SSB2) (Hsp70 chaperone Ssb) | EBI-3801989 | 0.35 |
| P22943 | 12 kDa heat shock protein (Glucose and lipid-regulated protein) | EBI-3831611 | 0.35 |
| P36160 | Ribosome biogenesis protein RPF2 | EBI-7433031 | 0.35 |
| Q00416 | Helicase SEN1 (EC 3.6.4.-) (tRNA-splicing endonuclease positive effector) | EBI-16421063 | 0.35 |
| P39109 | Metal resistance protein YCF1 (ABC-type Cd(2+) transporter) (EC 7.2.2.2) (ABC-type glutathione-S-conjugate transporter) (EC 7.6.2.3) (Yeast cadmium factor 1) | EBI-20816574 | 0.37 |
| P38011 | Guanine nucleotide-binding protein subunit beta-like protein (Receptor for activated C kinase) (Receptor of activated protein kinase C 1) (RACK1) (Small ribosomal subunit protein RACK1) | EBI-26974569 | 0.78 |
Database | Links |
| UNIPROT | P39015 D6VYE5 |
| PDB | 4U3M 4U3N 4U3U 4U4N 4U4O 4U4Q 4U4R 4U4U 4U4Y 4U4Z 4U50 4U51 4U52 4U53 4U55 4U56 4U6F 4V88 4V8Y 4V8Z 5DAT 5DC3 5DGE 5FCI 5FCJ 5I4L 5LYB 5NDG 5NDV 5NDW 5OBM 5TGA 5TGM 6HHQ |
| Pfam | PF09598 |
National and Kapodistrian University of Athens
Department of Biology
Biophysics & Bioinformatics Laboratory