NucEnvDB

NucEnvDB

A database of Nuclear Envelope Proteins and their Interactions

Pheromone-regulated membrane protein 3 - Saccharomyces cerevisiae S288C - NucEnvDB

Pheromone-regulated membrane protein 3 (Saccharomyces cerevisiae S288C)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	Pheromone-regulated membrane protein 3
Accession Code	Q08931
Gene	PRM3
Organism	Saccharomyces cerevisiae S288C (Taxonomy: 559292)
Part of Reference Proteome?	Yes
Sequence (Length: 133)
MTAMKEDNAALITLKKNNDQEKLRVHKLTDASSNSADGFVINKAKNGGPLNKKSLVNNEQHIKKAVSPGRVRKHKTTTSSTKSRTKSKKKDASESKVQRENKGSFYQGAIFGSFLGAAVTTVLSNLAVKA LQN

Subcellular Location

Description
Nucleus outer membrane; Single-pass membrane protein; Cytoplasmic side. Cytoplasm, cytoskeleton, microtubule organizing center, spindle pole body.
Position in the Nuclear Envelope
Location	Location ID	Description
Nuclear Envelope	SL-0178	The nuclear envelope is a membrane system which surrounds the nucleoplasm of eukaryotic cells. It is composed of the nuclear lamina, nuclear pore complexes and two nuclear membranes. The space between the two membranes is called the nuclear intermembrane space.
Nuclear Membrane	SL-0182	The membrane surrounding the nucleus. This term is used when it is not known if the protein is found in or associated with the inner or outer nuclear membrane.
Nuclear Outer Membrane	SL-0183	The outer membrane of the nucleus is the membrane facing the cytoplasm. In mammals, the outer nuclear membrane is continuous in many places with the rough endoplasmic reticulum and is dotted with ribosomes.
Membrane Topology
Topology	Source	Annotation Type
Transmembrane	UniProt	Sequence Analysis {ECO:0000255}
Assigned Ontology terms

Cellular Component	Cytoplasm (GO:0005737) Extrinsic Component Of Nuclear Outer Membrane (GO:0031316) Nuclear Envelope (GO:0005635) Nuclear Periphery (GO:0034399) Spindle Pole Body (GO:0005816)

Biology & Function

Description
Required for the fusion of nuclear envelopes during mating, ensuring proper karyogamy. Plays a role in the initiation of outer nuclear envelope fusion. {Experimental EvidencePubMed:12514182, Experimental EvidencePubMed:19297527, Experimental EvidencePubMed:19570912}.
Assigned Ontology terms

Biological Process	Karyogamy Involved In Conjugation With Cellular Fusion (GO:0000742) Nuclear Membrane Fusion Involved In Karyogamy (GO:0048288)
Molecular Function

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (1 interactors)

Partner (NucEnvDB)		IntAct	Confidence score
Q08931	Self	EBI-392676	0.37
Interactions with other proteins (7 interactors)

Partner (UniProt)		IntAct	Confidence score
P38987	Protein TEM1	EBI-391647	0.37
P38555	GTP-binding protein YPT31/YPT8 (Rab GTPase YPT31)	EBI-392733	0.37
P32602	Alpha-soluble NSF attachment protein (SNAP-alpha) (N-ethylmaleimide-sensitive factor attachment protein alpha) (Vesicular-fusion protein SEC17) (alpha-SNAP chaperone)	EBI-394017	0.37
Q99260	GTP-binding protein YPT6	EBI-394311	0.37
P38074	Protein arginine N-methyltransferase 1 (EC 2.1.1.-) (Major type I protein arginine N-methyltransferase) (Type I PRMT) (hnRNP arginine N-methyltransferase)	EBI-856087	0.00
P40857	Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase PHS1 (EC 4.2.1.134) (3-hydroxyacyl-CoA dehydratase PHS1) (HACD) (PTPLA homolog involved in sphingolipid biosynthesis protein 1)	EBI-856585	0.00
P47088	GPI mannosyltransferase 1 (EC 2.4.1.-) (GPI mannosyltransferase I) (GPI-MT-I) (Glycosylphosphatidylinositol-anchor biosynthesis protein 14)	EBI-856681	0.00

Cross-References

Database	Links
UNIPROT	Q08931 D6W3H6

Powered by W3.css | Privacy Notice

x

This website uses cookies to improve user experience. By using NucEnvDB you consent to all cookies in accordance with our privacy policy. OK