Leucine-rich repeat-containing protein 59, N-terminally processed - Homo sapiens

Leucine-rich repeat-containing protein 59, N-terminally processed (Homo sapiens)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	Leucine-rich repeat-containing protein 59, N-terminally processed
Accession Code	Q96AG4
Gene	LRRC59
Organism	Homo sapiens \| Human (Taxonomy: 9606)
Part of Reference Proteome?	Yes
Sequence (Length: 307)
MTKAGSKGGNLRDKLDGNELDLSLSDLNEVPVKELAALPKATILDLSCNKLTTLPSDFCGLTHLVKLDLSKNKLQQLPADFGRLVNLQHLDLLNNKLVTLPVSFAQLKNLKWLDLKDNPLDPVLAKVAGD CLDEKQCKQCANKVLQHMKAVQADQERERQRRLEVEREAEKKREAKQRAKEAQERELRKREKAEEKERRRKEYDALKAAKREQEKKPKKEANQAPKSKSGSRPRKPPPRKHTRSWAVLKLLLLLLLFGVA GGLVACRVTELQQQPLCTSVNTIYDNAVQGLRRHEILQWVLQTDSQQ

Subcellular Location

Description
Microsome membrane {By Similarity}; Single-pass type II membrane protein {By Similarity}. Endoplasmic reticulum membrane; Single-pass type II membrane protein. Nucleus envelope. Note=Localization in the nuclear envelope depends upon the nuclear import machinery, including KPNB1.
Position in the Nuclear Envelope
Location	Location ID	Description
Nuclear Envelope	SL-0178	The nuclear envelope is a membrane system which surrounds the nucleoplasm of eukaryotic cells. It is composed of the nuclear lamina, nuclear pore complexes and two nuclear membranes. The space between the two membranes is called the nuclear intermembrane space.
Membrane Topology
Topology	Source	Annotation Type
Transmembrane	UniProt	Sequence Analysis {ECO:0000255}
Assigned Ontology terms

Cellular Component	Endoplasmic Reticulum (GO:0005783) Endoplasmic Reticulum Membrane (GO:0005789) Membrane (GO:0016020) Mitochondrial Nucleoid (GO:0042645) Nuclear Envelope (GO:0005635)

Biology & Function

Description
Required for nuclear import of FGF1, but not that of FGF2. Might regulate nuclear import of exogenous FGF1 by facilitating interaction with the nuclear import machinery and by transporting cytosolic FGF1 to, and possibly through, the nuclear pores. {Experimental EvidencePubMed:22321063}.
Assigned Ontology terms

Biological Process	Positive Regulation Of Ras Protein Signal Transduction (GO:0046579) Signal Transduction (GO:0007165)
Molecular Function	Cadherin Binding (GO:0045296) RNA Binding (GO:0003723)

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (8 interactors)

Partner (NucEnvDB)		IntAct	Confidence score
P01112	GTPase HRas, N-terminally processed	EBI-27045317	0.27
P12931	Proto-oncogene tyrosine-protein kinase Src	EBI-25384369	0.35
Q5BJF2	Sigma intracellular receptor 2	EBI-24560640	0.56
Q9Y2K6	Ubiquitin carboxyl-terminal hydrolase 20	EBI-2512022	0.40
Q99IB8	RNA-directed RNA polymerase	EBI-11422269	0.35
P00519	Tyrosine-protein kinase ABL1	EBI-10101379	0.35
Q15125	3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase	EBI-24548327	0.56
P00533	Epidermal growth factor receptor	EBI-702075	0.35
Interactions with other proteins (125 interactors)

Partner (UniProt)		IntAct	Confidence score
P19438	Tumor necrosis factor receptor superfamily member 1A (Tumor necrosis factor receptor 1) (TNF-R1) (Tumor necrosis factor receptor type I) (TNF-RI) (TNFR-I) (p55) (p60) (CD antigen CD120a) [Cleaved into: Tumor necrosis factor receptor superfamily member 1A, membrane form; Tumor necrosis factor-binding protein 1 (TBPI)]	EBI-364474	0.00
P40337	von Hippel-Lindau disease tumor suppressor (Protein G7) (pVHL)	EBI-1061500	0.00
P78396	Cyclin-A1	EBI-1065388	0.00
P23508	Colorectal mutant cancer protein (Protein MCC)	EBI-1066087	0.00
Q9UET6	Putative tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase (EC 2.1.1.205) (2'-O-ribose RNA methyltransferase TRM7 homolog) (Protein ftsJ homolog 1)	EBI-1069061	0.00
Q9H1Y0	Autophagy protein 5 (APG5-like) (Apoptosis-specific protein)	EBI-1070756	0.00
P56537	Eukaryotic translation initiation factor 6 (eIF-6) (B(2)GCN homolog) (B4 integrin interactor) (CAB) (p27(BBP))	EBI-1071348	0.00
Q9UKE5	TRAF2 and NCK-interacting protein kinase (EC 2.7.11.1)	EBI-1073298	0.00
Q14164	Inhibitor of nuclear factor kappa-B kinase subunit epsilon (I-kappa-B kinase epsilon) (IKK-E) (IKK-epsilon) (IkBKE) (EC 2.7.11.10) (Inducible I kappa-B kinase) (IKK-i)	EBI-1075053	0.00
P11171	Protein 4.1 (P4.1) (4.1R) (Band 4.1) (EPB4.1) (Erythrocyte membrane protein band 4.1)	EBI-1076336	0.00
O75815	Breast cancer anti-estrogen resistance protein 3 (Novel SH2-containing protein 2) (SH2 domain-containing protein 3B)	EBI-1077503	0.00
Q9Y4K3	TNF receptor-associated factor 6 (EC 2.3.2.27) (E3 ubiquitin-protein ligase TRAF6) (Interleukin-1 signal transducer) (RING finger protein 85) (RING-type E3 ubiquitin transferase TRAF6)	EBI-1078796	0.00
Q9Y478	5'-AMP-activated protein kinase subunit beta-1 (AMPK subunit beta-1) (AMPKb)	EBI-1079493	0.00
P01889	HLA class I histocompatibility antigen, B alpha chain (Human leukocyte antigen B) (HLA-B)	EBI-1083352	0.00
P29372	DNA-3-methyladenine glycosylase (EC 3.2.2.21) (3-alkyladenine DNA glycosylase) (3-methyladenine DNA glycosidase) (ADPG) (N-methylpurine-DNA glycosylase)	EBI-1084066	0.00
P48039	Melatonin receptor type 1A (Mel-1A-R) (Mel1a receptor)	EBI-1188258	0.53
Q9UL18	Protein argonaute-1 (Argonaute1) (hAgo1) (Argonaute RISC catalytic component 1) (Eukaryotic translation initiation factor 2C 1) (eIF-2C 1) (eIF2C 1) (Putative RNA-binding protein Q99)	EBI-7641579	0.35
P01100	Protein c-Fos (Cellular oncogene fos) (Fos proto-oncogene, AP-1 transcription factor subunit) (G0/G1 switch regulatory protein 7) (Proto-oncogene c-Fos) (Transcription factor AP-1 subunit c-Fos)	EBI-2687467	0.00
Q92731	Estrogen receptor beta (ER-beta) (Nuclear receptor subfamily 3 group A member 2)	EBI-2880211	0.46
Q9Y371	Endophilin-B1 (Bax-interacting factor 1) (Bif-1) (SH3 domain-containing GRB2-like protein B1)	EBI-3622855	0.35
P51858	Hepatoma-derived growth factor (HDGF) (High mobility group protein 1-like 2) (HMG-1L2)	EBI-4409719	0.35
P68400	Casein kinase II subunit alpha (CK II alpha) (EC 2.7.11.1)	EBI-5321978	0.44
P0DOE9	Non-structural protein 1 (NS1) (Non-structural protein 1C)	EBI-6138583	0.35
P19320	Vascular cell adhesion protein 1 (V-CAM 1) (VCAM-1) (INCAM-100) (CD antigen CD106)	EBI-6189915	0.35
P02751	Fibronectin (FN) (Cold-insoluble globulin) (CIG) [Cleaved into: Anastellin; Ugl-Y1; Ugl-Y2; Ugl-Y3]	EBI-6285956	0.35
Q86VP6	Cullin-associated NEDD8-dissociated protein 1 (Cullin-associated and neddylation-dissociated protein 1) (TBP-interacting protein of 120 kDa A) (TBP-interacting protein 120A) (p120 CAND1)	EBI-21322532	0.35
P67809	Y-box-binding protein 1 (YB-1) (CCAAT-binding transcription factor I subunit A) (CBF-A) (DNA-binding protein B) (DBPB) (Enhancer factor I subunit A) (EFI-A) (Nuclease-sensitive element-binding protein 1) (Y-box transcription factor)	EBI-8853354	0.56
P57078	Receptor-interacting serine/threonine-protein kinase 4 (EC 2.7.11.1) (Ankyrin repeat domain-containing protein 3) (PKC-delta-interacting protein kinase)	EBI-12503575	0.35
P10398	Serine/threonine-protein kinase A-Raf (EC 2.7.11.1) (Proto-oncogene A-Raf) (Proto-oncogene A-Raf-1) (Proto-oncogene Pks)	EBI-10101513	0.35
O60307	Microtubule-associated serine/threonine-protein kinase 3 (EC 2.7.11.1)	EBI-10103761	0.35
Q96FW1	Ubiquitin thioesterase OTUB1 (EC 3.4.19.12) (Deubiquitinating enzyme OTUB1) (OTU domain-containing ubiquitin aldehyde-binding protein 1) (Otubain-1) (hOTU1) (Ubiquitin-specific-processing protease OTUB1)	EBI-10770198	0.35
P05412	Transcription factor Jun (Activator protein 1) (AP1) (Proto-oncogene c-Jun) (Transcription factor AP-1 subunit Jun) (V-jun avian sarcoma virus 17 oncogene homolog) (p39)	EBI-11323169	0.35
P06461	Probable protein E5B	EBI-11723785	0.35
Q9JLQ0	CD2-associated protein (Mesenchyme-to-epithelium transition protein with SH3 domains 1) (METS-1)	EBI-11033702	0.35
P35749	Myosin-11 (Myosin heavy chain 11) (Myosin heavy chain, smooth muscle isoform) (SMMHC)	EBI-11098041	0.35
Q9NPD3	Exosome complex component RRP41 (Exosome component 4) (Ribosomal RNA-processing protein 41) (p12A)	EBI-11126463	0.35
Q15006	ER membrane protein complex subunit 2 (Tetratricopeptide repeat protein 35) (TPR repeat protein 35)	EBI-11130215	0.35
Q9NVD3	SET domain-containing protein 4 (EC 2.1.1.-) (EC 2.1.1.364)	EBI-11154093	0.35
Q6NUS6	Tectonic-3	EBI-11368748	0.27
Q96GX1	Tectonic-2	EBI-11375285	0.27
Q9P0N5	Transmembrane protein 216	EBI-11378021	0.27
Q96Q45	Transmembrane protein 237 (Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 4 protein)	EBI-11396533	0.27
Q9H2L4	Transmembrane protein 60	EBI-24519719	0.56
Q9H0R3	Transmembrane protein 222	EBI-24521426	0.56
Q96MX0	CKLF-like MARVEL transmembrane domain-containing protein 3 (Chemokine-like factor superfamily member 3)	EBI-24523693	0.56
Q6UX34	Protein SNORC (Secondary ossification center-associated regulator of chondrocyte maturation protein)	EBI-24629651	0.56
P55061	Bax inhibitor 1 (BI-1) (Testis-enhanced gene transcript protein) (Transmembrane BAX inhibitor motif-containing protein 6)	EBI-24424978	0.56
Q5VZY2	Phospholipid phosphatase 4 (EC 3.1.3.4) (EC 3.1.3.81) (Phosphatidic acid phosphatase type 2 domain-containing protein 1A)	EBI-24537950	0.56
P56851	Epididymal secretory protein E3-beta (Human epididymis-specific protein 3-beta) (HE3-beta)	EBI-24543931	0.56
Q5TGU0	Translocator protein 2 (Peripheral-type benzodiazepine receptor-like protein 1)	EBI-24553760	0.56
O95406	Protein cornichon homolog 1 (CNIH-1) (Cornichon family AMPA receptor auxiliary protein 1) (Protein cornichon homolog) (T-cell growth-associated molecule 77) (TGAM77)	EBI-24558366	0.56
Q6RW13	Type-1 angiotensin II receptor-associated protein (AT1 receptor-associated protein)	EBI-24562799	0.56
Q96DZ9	CKLF-like MARVEL transmembrane domain-containing protein 5 (Chemokine-like factor superfamily member 5)	EBI-24576076	0.56
Q9ULP0	Protein NDRG4 (Brain development-related molecule 1) (N-myc downstream-regulated gene 4 protein) (Vascular smooth muscle cell-associated protein 8) (SMAP-8)	EBI-24580735	0.56
Q8N609	Translocating chain-associated membrane protein 1-like 1	EBI-24593407	0.56
P29972	Aquaporin-1 (AQP-1) (Aquaporin-CHIP) (Urine water channel) (Water channel protein for red blood cells and kidney proximal tubule)	EBI-24603065	0.56
P56945	Breast cancer anti-estrogen resistance protein 1 (CRK-associated substrate) (Cas scaffolding protein family member 1) (p130cas)	EBI-15099384	0.35
Q6IQ23	Pleckstrin homology domain-containing family A member 7 (PH domain-containing family A member 7)	EBI-16398399	0.35
Q12797	Aspartyl/asparaginyl beta-hydroxylase (EC 1.14.11.16) (Aspartate beta-hydroxylase) (ASP beta-hydroxylase) (Peptide-aspartate beta-dioxygenase)	EBI-21649522	0.35
Q14684	Ribosomal RNA processing protein 1 homolog B (RRP1-like protein B)	EBI-16685608	0.35
P27824	Calnexin (IP90) (Major histocompatibility complex class I antigen-binding protein p88) (p90)	EBI-16788621	0.42
P11279	Lysosome-associated membrane glycoprotein 1 (LAMP-1) (Lysosome-associated membrane protein 1) (CD107 antigen-like family member A) (CD antigen CD107a)	EBI-16794808	0.27
P08559	Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial (EC 1.2.4.1) (PDHE1-A type I)	EBI-20306509	0.35
Q9HCE5	N6-adenosine-methyltransferase non-catalytic subunit (Methyltransferase-like protein 14) (hMETTL14)	EBI-20595531	0.35
P05067	Amyloid-beta precursor protein (APP) (ABPP) (APPI) (Alzheimer disease amyloid A4 protein homolog) (Alzheimer disease amyloid protein) (Amyloid precursor protein) (Amyloid-beta (A4) precursor protein) (Amyloid-beta A4 protein) (Cerebral vascular amyloid peptide) (CVAP) (PreA4) (Protease nexin-II) (PN-II) [Cleaved into: N-APP; Soluble APP-alpha (S-APP-alpha); Soluble APP-beta (S-APP-beta); C99 (Beta-secretase C-terminal fragment) (Beta-CTF); Amyloid-beta protein 42 (Abeta42) (Beta-APP42); Amyloid-beta protein 40 (Abeta40) (Beta-APP40); C83 (Alpha-secretase C-terminal fragment) (Alpha-CTF); P3(42); P3(40); C80; Gamma-secretase C-terminal fragment 59 (Amyloid intracellular domain 59) (AICD-59) (AID(59)) (Gamma-CTF(59)); Gamma-secretase C-terminal fragment 57 (Amyloid intracellular domain 57) (AICD-57) (AID(57)) (Gamma-CTF(57)); Gamma-secretase C-terminal fragment 50 (Amyloid intracellular domain 50) (AICD-50) (AID(50)) (Gamma-CTF(50)); C31]	EBI-20821761	0.35
O95819	Mitogen-activated protein kinase kinase kinase kinase 4 (EC 2.7.11.1) (HPK/GCK-like kinase HGK) (MAPK/ERK kinase kinase kinase 4) (MEK kinase kinase 4) (MEKKK 4) (Nck-interacting kinase)	EBI-20900495	0.40
Q00765	Receptor expression-enhancing protein 5 (Polyposis locus protein 1) (Protein TB2)	EBI-20901832	0.40
Q9Y5A6	Zinc finger and SCAN domain-containing protein 21 (Renal carcinoma antigen NY-REN-21) (Zinc finger protein 38 homolog) (Zfp-38)	EBI-20903696	0.40
O76021	Ribosomal L1 domain-containing protein 1 (CATX-11) (Cellular senescence-inhibited gene protein) (Protein PBK1)	EBI-20906176	0.40
P62917	60S ribosomal protein L8 (Large ribosomal subunit protein uL2)	EBI-20907960	0.40
Q9UL63	Muskelin	EBI-20908464	0.40
B3KS81	Serine/arginine repetitive matrix protein 5	EBI-20908696	0.40
Q9Y3D0	Cytosolic iron-sulfur assembly component 2B (MSS19-interacting protein of 18 kDa) (Mitotic spindle-associated MMXD complex subunit MIP18) (Protein FAM96B)	EBI-20909184	0.40
Q15648	Mediator of RNA polymerase II transcription subunit 1 (Activator-recruited cofactor 205 kDa component) (ARC205) (Mediator complex subunit 1) (Peroxisome proliferator-activated receptor-binding protein) (PBP) (PPAR-binding protein) (Thyroid hormone receptor-associated protein complex 220 kDa component) (Trap220) (Thyroid receptor-interacting protein 2) (TR-interacting protein 2) (TRIP-2) (Vitamin D receptor-interacting protein complex component DRIP205) (p53 regulatory protein RB18A)	EBI-20910000	0.40
Q8ND76	Cyclin-Y (Cyc-Y) (Cyclin box protein 1) (Cyclin fold protein 1) (cyclin-X)	EBI-20923706	0.40
Q9UPN4	Centrosomal protein of 131 kDa (5-azacytidine-induced protein 1) (Pre-acrosome localization protein 1)	EBI-20923938	0.40
Q5VUA4	Zinc finger protein 318 (Endocrine regulatory protein)	EBI-20932048	0.40
Q9ULD8	Potassium voltage-gated channel subfamily H member 3 (Brain-specific eag-like channel 1) (BEC1) (Ether-a-go-go-like potassium channel 2) (ELK channel 2) (ELK2) (Voltage-gated potassium channel subunit Kv12.2)	EBI-20933132	0.40
A2A935	Histone-lysine N-methyltransferase PRDM16 (EC 2.1.1.367) (PR domain zinc finger protein 16) (PR domain-containing protein 16) (Transcription factor MEL1) (MDS1/EVI1-like gene 1)	EBI-21022882	0.35
P14404	Histone-lysine N-methyltransferase MECOM (EC 2.1.1.367) (Ecotropic virus integration site 1 protein) (EVI-1) (MDS1 and EVI1 complex locus protein) (Myelodysplasia syndrome 1 protein homolog)	EBI-21026252	0.35
Q5S007	Leucine-rich repeat serine/threonine-protein kinase 2 (EC 2.7.11.1) (EC 3.6.5.-) (Dardarin)	EBI-21360986	0.35
Q15077	P2Y purinoceptor 6 (P2Y6)	EBI-21262943	0.35
F5H1C8	Solute carrier family 15 member 3 (Solute carrier family 15, member 3, isoform CRA_a)	EBI-21264930	0.35
Q9H1C4	Protein unc-93 homolog B1 (Unc-93B1) (hUNC93B1)	EBI-21266770	0.35
P12004	Proliferating cell nuclear antigen (PCNA) (Cyclin)	EBI-21236980	0.37
Q00059	Transcription factor A, mitochondrial (mtTFA) (Mitochondrial transcription factor 1) (MtTF1) (Transcription factor 6) (TCF-6) (Transcription factor 6-like 2)	EBI-21980665	0.35
Q04837	Single-stranded DNA-binding protein, mitochondrial (Mt-SSB) (MtSSB) (PWP1-interacting protein 17)	EBI-21980936	0.35
O15530	3-phosphoinositide-dependent protein kinase 1 (hPDK1) (EC 2.7.11.1)	EBI-25375702	0.35
O84008	Uncharacterized protein CT_005	EBI-22302433	0.35
P0DJI4	Inclusion membrane protein E	EBI-22303808	0.35
Q8NF50	Dedicator of cytokinesis protein 8	EBI-25409278	0.35
Q6ZRI8	Rho GTPase-activating protein 36	EBI-25410669	0.35
P0DOF2	Matrix protein (Phosphoprotein M2)	EBI-25603126	0.35
Q8NHP6	Motile sperm domain-containing protein 2	EBI-25617558	0.35
P60033	CD81 antigen (26 kDa cell surface protein TAPA-1) (Target of the antiproliferative antibody 1) (Tetraspanin-28) (Tspan-28) (CD antigen CD81)	EBI-25645944	0.35
Q8NBM4	Ubiquitin-associated domain-containing protein 2 (UBA domain-containing protein 2) (Phosphoglycerate dehydrogenase-like protein 1)	EBI-25771384	0.35
Q53F19	Nuclear cap-binding protein subunit 3 (Protein ELG)	EBI-26396827	0.35
Q8TB24	Ras and Rab interactor 3 (Ras interaction/interference protein 3)	EBI-26518569	0.35
Q8NDZ4	Divergent protein kinase domain 2A (Deleted in autism protein 1) (Golgi Protein of 49 kDa) (GoPro49) (Hypoxia and AKT-induced stem cell factor) (HASF)	EBI-26597064	0.35
P01116	GTPase KRas (EC 3.6.5.2) (K-Ras 2) (Ki-Ras) (c-K-ras) (c-Ki-ras) [Cleaved into: GTPase KRas, N-terminally processed]	EBI-27041844	0.27
P01111	GTPase NRas (EC 3.6.5.2) (Transforming protein N-Ras)	EBI-27042293	0.27
Q13363	C-terminal-binding protein 1 (CtBP1) (EC 1.1.1.-)	EBI-27044482	0.35
F1PAA9	Cadherin-1 (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) [Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3]	EBI-27079701	0.27
A0A0H3NFP4	SPI-2 type III secretion system effector SifA (Type III secretion system effector protein-necessary for Sif formation and maintaining the SCV. Has GAP activity)	EBI-27055788	0.27
A0A0H3NG92	Type III secretion system effector protein-regulates and maintains the SCV (Type III secretion systems effector SseF)	EBI-27055968	0.27
A0A0H3NF08	SPI-2 type III secretion system effector PipB2 (Type III secretion system effector protein, Contributes to Sif formation)	EBI-27055973	0.27
A0A0H3NJM6	SPI-2 type III secretion system effector SopD2 (Type III secretion system effector protein)	EBI-27055978	0.27
A0A0H3NB75	Pathogenicity island 2 effector protein SseG (Type III secretion system effector protein-modulates the positioning of the SCV)	EBI-27055983	0.27
P35226	Polycomb complex protein BMI-1 (Polycomb group RING finger protein 4) (RING finger protein 51)	EBI-27109494	0.35
P13569	Cystic fibrosis transmembrane conductance regulator (CFTR) (ATP-binding cassette sub-family C member 7) (Channel conductance-controlling ATPase) (EC 5.6.1.6) (cAMP-dependent chloride channel)	EBI-27087549	0.35
O60285	NUAK family SNF1-like kinase 1 (EC 2.7.11.1) (AMPK-related protein kinase 5) (ARK5) (Omphalocele kinase 1)	EBI-28931176	0.35
P04049	RAF proto-oncogene serine/threonine-protein kinase (EC 2.7.11.1) (Proto-oncogene c-RAF) (cRaf) (Raf-1)	EBI-28931531	0.35
P20794	Serine/threonine-protein kinase MAK (EC 2.7.11.1) (Male germ cell-associated kinase)	EBI-28934658	0.35
P32298	G protein-coupled receptor kinase 4 (EC 2.7.11.16) (G protein-coupled receptor kinase GRK4) (ITI1)	EBI-28934990	0.35
P36507	Dual specificity mitogen-activated protein kinase kinase 2 (MAP kinase kinase 2) (MAPKK 2) (EC 2.7.12.2) (ERK activator kinase 2) (MAPK/ERK kinase 2) (MEK 2)	EBI-28935019	0.35
Q86V86	Serine/threonine-protein kinase pim-3 (EC 2.7.11.1)	EBI-28942203	0.35
Q8NI60	Atypical kinase COQ8A, mitochondrial (EC 2.7.-.-) (Chaperone activity of bc1 complex-like) (Chaperone-ABC1-like) (Coenzyme Q protein 8A) (aarF domain-containing protein kinase 3)	EBI-28943519	0.35
Q9UPE1	SRSF protein kinase 3 (EC 2.7.11.1) (Muscle-specific serine kinase 1) (MSSK-1) (Serine/arginine-rich protein-specific kinase 3) (SR-protein-specific kinase 3) (Serine/threonine-protein kinase 23)	EBI-28946981	0.35
Q9UIH9	Krueppel-like factor 15 (Kidney-enriched krueppel-like factor)	EBI-29019642	0.35
Q9BXK1	Krueppel-like factor 16 (Basic transcription element-binding protein 4) (BTE-binding protein 4) (Novel Sp1-like zinc finger transcription factor 2) (Transcription factor BTEB4) (Transcription factor NSLP2)	EBI-29019783	0.35
O95600	Krueppel-like factor 8 (Basic krueppel-like factor 3) (Zinc finger protein 741)	EBI-29020196	0.35
P01106	Myc proto-oncogene protein (Class E basic helix-loop-helix protein 39) (bHLHe39) (Proto-oncogene c-Myc) (Transcription factor p64)	EBI-29661630	0.27
P29322	Ephrin type-A receptor 8 (EC 2.7.10.1) (EPH- and ELK-related kinase) (EPH-like kinase 3) (EK3) (hEK3) (Tyrosine-protein kinase receptor EEK)	EBI-32718189	0.35
P08069	Insulin-like growth factor 1 receptor (EC 2.7.10.1) (Insulin-like growth factor I receptor) (IGF-I receptor) (CD antigen CD221) [Cleaved into: Insulin-like growth factor 1 receptor alpha chain; Insulin-like growth factor 1 receptor beta chain]	EBI-32718669	0.35
Q06418	Tyrosine-protein kinase receptor TYRO3 (EC 2.7.10.1) (Tyrosine-protein kinase BYK) (Tyrosine-protein kinase DTK) (Tyrosine-protein kinase RSE) (Tyrosine-protein kinase SKY) (Tyrosine-protein kinase TIF)	EBI-32719716	0.35

Cross-References

Database	Links
UNIPROT	Q96AG4 B2RE83 D3DTX8 Q9P189
Pfam	PF13855
PROSITE	PS51450
OMIM	614854
DisGeNET	55379

Leucine-rich repeat-containing protein 59, N-terminally processed (Homo sapiens)

General Information

Protein Information

Subcellular Location

Description Show

Position in the Nuclear Envelope

Membrane Topology

Assigned Ontology terms

Biology & Function

Description Hide

Assigned Ontology terms

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (8 interactors)

Interactions with other proteins (125 interactors)

Cross-References

Database

Links

Description

Description