NucEnvDB

NucEnvDB

A database of Nuclear Envelope Proteins and their Interactions

Guanylate-binding protein 4 - Homo sapiens - NucEnvDB

Guanylate-binding protein 4 (Homo sapiens)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	Guanylate-binding protein 4
Accession Code	Q96PP9
Gene	GBP4
Organism	Homo sapiens \| Human (Taxonomy: 9606)
Part of Reference Proteome?	Yes
Sequence (Length: 640)
MGERTLHAAVPTPGYPESESIMMAPICLVENQEEQLTVNSKALEILDKISQPVVVVAIVGLYRTGKSYLMNRLAGKRNGFPLGSTVQSETKGIWMWCVPHLSKPNHTLVLLDTEGLGDVEKSNPKNDSWI FALAVLLSSSFVYNSVSTINHQALEQLHYVTELAELIRAKSCPRPDEAEDSSEFASFFPDFIWTVRDFTLELKLDGNPITEDEYLENALKLIPGKNPKIQNSNMPRECIRHFFRKRKCFVFDRPTNDKQY LNHMDEVPEENLERHFLMQSDNFCSYIFTHAKTKTLREGIIVTGKRLGTLVVTYVDAINSGAVPCLENAVTALAQLENPAAVQRAADHYSQQMAQQLRLPTDTLQELLDVHAACEREAIAVFMEHSFKDE NHEFQKKLVDTIEKKKGDFVLQNEEASAKYCQAELKRLSEHLTESILRGIFSVPGGHNLYLEEKKQVEWDYKLVPRKGVKANEVLQNFLQSQVVVEESILQSDKALTAGEKAIAAERAMKEAAEKEQELL REKQKEQQQMMEAQERSFQEYMAQMEKKLEEERENLLREHERLLKHKLKVQEEMLKEEFQKKSEQLNKEINQLKEKIESTKNEQLRLLKILDMASNIMIVTLPGASKLLGVGTKYLGSRI

Subcellular Location

Description
Cytoplasm {Experimental EvidencePubMed:17266443}. Nucleus {Experimental EvidencePubMed:17266443}. Cytoplasm, perinuclear region {ECO:0000269\|PubMed:21151871}. Golgi apparatus membrane {ECO:0000269\|PubMed:21151871}. Note=Heterodimers with GBP1, GBP2 and GBP5 localize in the compartment of the prenylated GBPs: with GBP1 in a vesicle-like compartment, with GBP2, around the nucleus and with GBP-5, at the Golgi apparatus. {ECO:0000269\|PubMed:21151871}.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Unknown	UniProt	Sequence Analysis
Assigned Ontology terms

Cellular Component	Cytoplasmic Vesicle (GO:0031410) Cytosol (GO:0005829) Golgi Apparatus (GO:0005794) Golgi Membrane (GO:0000139) Nucleus (GO:0005634) Perinuclear Region Of Cytoplasm (GO:0048471) Plasma Membrane (GO:0005886)

Biology & Function

Description
Binds GTP, GDP and GMP. Hydrolyzes GTP very efficiently; GDP rather than GMP is the major reaction product. Plays a role in erythroid differentiation (By similarity). {By Similarity}.
Assigned Ontology terms

Biological Process	Cellular Response To Type II Interferon (GO:0071346) Defense Response To Gram-Positive Bacterium (GO:0050830) Defense Response To Protozoan (GO:0042832)
Molecular Function	GTP Binding (GO:0005525) GTPase Activity (GO:0003924) Identical Protein Binding (GO:0042802) Protein Homodimerization Activity (GO:0042803)

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (2 interactors)

Partner (NucEnvDB)		IntAct	Confidence score
Q96PP9	Self	EBI-26472586	0.51
P32456	Guanylate-binding protein 2	EBI-26472562	0.51
Interactions with other proteins (3 interactors)

Partner (UniProt)		IntAct	Confidence score
Q8TCS8	Polyribonucleotide nucleotidyltransferase 1, mitochondrial (EC 2.7.7.8) (3'-5' RNA exonuclease OLD35) (PNPase old-35) (Polynucleotide phosphorylase 1) (PNPase 1) (Polynucleotide phosphorylase-like protein)	EBI-20907752	0.40
P32455	Guanylate-binding protein 1 (EC 3.6.5.-) (GTP-binding protein 1) (GBP-1) (HuGBP-1) (Guanine nucleotide-binding protein 1) (Interferon-induced guanylate-binding protein 1)	EBI-26472554	0.51
Q96PP8	Guanylate-binding protein 5 (EC 3.6.5.-) (GBP-TA antigen) (GTP-binding protein 5) (GBP-5) (Guanine nucleotide-binding protein 5)	EBI-26472602	0.51

Cross-References

Database	Links
UNIPROT	Q96PP9 B2R630 Q05D63 Q6NSL0 Q86T99
Pfam	PF02263 PF02841
PROSITE	PS51715
OMIM	612466
DisGeNET	115361

Powered by W3.css | Privacy Notice

x

This website uses cookies to improve user experience. By using NucEnvDB you consent to all cookies in accordance with our privacy policy. OK