Protein Information |
|
|---|---|
| Protein Name | Erbin |
| Accession Code | Q96RT1 |
| Gene | ERBIN |
| Organism | Homo sapiens | Human (Taxonomy: 9606) |
| Part of Reference Proteome? | Yes |
| Sequence (Length: 1412) | |
|
MTTKRSLFVRLVPCRCLRGEEETVTTLDYSHCSLEQVPKEIFTFEKTLEELYLDANQIEELPKQLFNCQSLHKLSLPDND LTTLPASIANLINLRELDVSKNGIQEFPENIKNCKVLTIVEASVNPISKLPDGFSQLLNLTQLYLNDAFLEFLPANFGRL TKLQILELRENQLKMLPKTMNRLTQLERLDLGSNEFTEVPEVLEQLSGLKEFWMDANRLTFIPGFIGSLKQLTYLDVSKN NIEMVEEGISTCENLQDLLLSSNSLQQLPETIGSLKNITTLKIDENQLMYLPDSIGGLISVEELDCSFNEVEALPSSIGQ LTNLRTFAADHNYLQQLPPEIGSWKNITVLFLHSNKLETLPEEMGDMQKLKVINLSDNRLKNLPFSFTKLQQLTAMWLSD NQSKPLIPLQKETDSETQKMVLTNYMFPQQPRTEDVMFISDNESFNPSLWEEQRKQRAQVAFECDEDKDEREAPPREGNL KRYPTPYPDELKNMVKTVQTIVHRLKDEETNEDSGRDLKPHEDQQDINKDVGVKTSESTTTVKSKVDEREKYMIGNSVQK ISEPEAEISPGSLPVTANMKASENLKHIVNHDDVFEESEELSSDEEMKMAEMRPPLIETSINQPKVVALSNNKKDDTKET DSLSDEVTHNSNQNNSNCSSPSRMSDSVSLNTDSSQDTSLCSPVKQTHIDINSKIRQEDENFNSLLQNGDILNSSTEEKF KAHDKKDFNLPEYDLNVEERLVLIEKSVDSTATADDTHKLDHINMNLNKLITNDTFQPEIMERSKTQDIVLGTSFLSINS KEETEHLENGNKYPNLESVNKVNGHSEETSQSPNRTEPHDSDCSVDLGISKSTEDLSPQKSGPVGSVVKSHSITNMEIGG LKIYDILSDNGPQQPSTTVKITSAVDGKNIVRSKSATLLYDQPLQVFTGSSSSSDLISGTKAIFKFDSNHNPEEPNIIRG PTSGPQSAPQIYGPPQYNIQYSSSAAVKDTLWHSKQNPQIDHASFPPQLLPRSESTENQSYAKHSANMNFSNHNNVRANT AYHLHQRLGPARHGEMWAISPNDRLIPAVTRSTIQRQSSVSSTASVNLGDPGSTRRAQIPEGDYLSYREFHSAGRTPPMM PGSQRPLSARTYSIDGPNASRPQSARPSINEIPERTMSVSDFNYSRTSPSKRPNARVGSEHSLLDPPGKSKVPRDWREQV LRHIEAKKLEKKHPQTSSSGDPCQDGIFISGQQNYSSATLSHKDVPPDSLMKMPLSNGQMGQPLRPQANYSQIHHPPQAS VARHPSREQLIDYLMLKVAHQPPYTQPHCSPRQGHELAKQEIRVRVEKDPELGFSISGGVGGRGNPFRPDDDGIFVTRVQ PEGPASKLLQPGDKIIQANGYSFINIEHGQAVSLLKTFQNTVELIIVREVSS |
|
Structure Viewer (PDB: 1MFL) |
|---|
Description |
||
|---|---|---|
| Cell junction, hemidesmosome {Experimental EvidencePubMed:10878805, Experimental EvidencePubMed:11375975}. Nucleus membrane {By Similarity}. Basolateral cell membrane {Experimental EvidencePubMed:16203728}. Note=Found in hemidesmosomes, which are cell-substrate adhesion complexes in stratified epithelia. In transfected cells, either diffusely distributed over the cytoplasm or concentrated at the basolateral membrane. Colocalizes with the adrenergic receptors, ADREN1A and ADREN1B, at the nuclear membrane of cardiac myocytes (By similarity). {By Similarity}. | Position in the Nuclear Envelope |
|
| Location | Location ID | Description |
| Nuclear Envelope | SL-0178 | The nuclear envelope is a membrane system which surrounds the nucleoplasm of eukaryotic cells. It is composed of the nuclear lamina, nuclear pore complexes and two nuclear membranes. The space between the two membranes is called the nuclear intermembrane space. |
| Nuclear Membrane | SL-0182 | The membrane surrounding the nucleus. This term is used when it is not known if the protein is found in or associated with the inner or outer nuclear membrane. | Membrane Topology |
| Topology | Source | Annotation Type |
| Unknown | UniProt | Sequence Analysis | Assigned Ontology terms |
| Cellular Component | Basal Plasma Membrane (GO:0009925) Basement Membrane (GO:0005604) Basolateral Plasma Membrane (GO:0016323) Cell Junction (GO:0030054) Cytoplasm (GO:0005737) Glutamatergic Synapse (GO:0098978) Hemidesmosome (GO:0030056) Nuclear Membrane (GO:0031965) Nuclear Speck (GO:0016607) Nucleus (GO:0005634) Plasma Membrane (GO:0005886) Postsynapse (GO:0098794) |
|
Interactions with Nuclear Envelope proteins (6 interactors) |
|||
|---|---|---|---|
| Partner (NucEnvDB) | IntAct | Confidence score | |
| O43542 | DNA repair protein XRCC3 | EBI-11129266 | 0.35 |
| Q16620 | BDNF/NT-3 growth factors receptor | EBI-32724423 | 0.27 |
| Q5XI72 | Eukaryotic translation initiation factor 4H | EBI-22258042 | 0.35 |
| Q6AXS5 | Plasminogen activator inhibitor 1 RNA-binding protein | EBI-22258042 | 0.35 |
| Q9Z1W6 | Protein LYRIC | EBI-22258042 | 0.35 |
| P00533 | Epidermal growth factor receptor | EBI-32720286 | 0.27 | Interactions with other proteins (164 interactors) |
| Partner (UniProt) | IntAct | Confidence score | |
| O95405 | Zinc finger FYVE domain-containing protein 9 (Mothers against decapentaplegic homolog-interacting protein) (Madh-interacting protein) (Novel serine protease) (NSP) (Receptor activation anchor) (hSARA) (Smad anchor for receptor activation) | EBI-7255424 | 0.37 |
| Q99569 | Plakophilin-4 (p0071) | EBI-8449263 | 0.63 |
| P35222 | Catenin beta-1 (Beta-catenin) | EBI-8449492 | 0.27 |
| Q9UQ13 | Leucine-rich repeat protein SHOC-2 (Protein soc-2 homolog) (Protein sur-8 homolog) | EBI-993893 | 0.62 |
| Q15796 | Mothers against decapentaplegic homolog 2 (MAD homolog 2) (Mothers against DPP homolog 2) (JV18-1) (Mad-related protein 2) (hMAD-2) (SMAD family member 2) (SMAD 2) (Smad2) (hSMAD2) | EBI-2695978 | 0.40 |
| P84022 | Mothers against decapentaplegic homolog 3 (MAD homolog 3) (Mad3) (Mothers against DPP homolog 3) (hMAD-3) (JV15-2) (SMAD family member 3) (SMAD 3) (Smad3) (hSMAD3) | EBI-2696171 | 0.40 |
| Q5NID9 | Elongation factor Tu (EF-Tu) | EBI-2805400 | 0.00 |
| Q8CZZ5 | Prophage CP4-57 integrase | EBI-2841600 | 0.00 |
| Q8CZQ2 | LysR-family transcriptional regulator LeuO (Probable transcriptional activator for leuABCD operon) | EBI-2865700 | 0.00 |
| P25054 | Adenomatous polyposis coli protein (Protein APC) (Deleted in polyposis 2.5) | EBI-3436880 | 0.00 |
| P01106 | Myc proto-oncogene protein (Class E basic helix-loop-helix protein 39) (bHLHe39) (Proto-oncogene c-Myc) (Transcription factor p64) | EBI-3893063 | 0.35 |
| P25791 | Rhombotin-2 (Cysteine-rich protein TTG-2) (LIM domain only protein 2) (LMO-2) (T-cell translocation protein 2) | EBI-3939532 | 0.37 |
| P40763 | Signal transducer and activator of transcription 3 (Acute-phase response factor) | EBI-3940529 | 0.37 |
| B1AYL1 | Sodium channel protein | EBI-8068438 | 0.44 |
| P36873 | Serine/threonine-protein phosphatase PP1-gamma catalytic subunit (PP-1G) (EC 3.1.3.16) (Protein phosphatase 1C catalytic subunit) | EBI-6911905 | 0.57 |
| P57078 | Receptor-interacting serine/threonine-protein kinase 4 (EC 2.7.11.1) (Ankyrin repeat domain-containing protein 3) (PKC-delta-interacting protein kinase) | EBI-12503575 | 0.35 |
| A2AUM9 | Centrosomal protein of 152 kDa (Cep152) | EBI-10994361 | 0.35 |
| Q96H55 | Unconventional myosin-XIX (Myosin head domain-containing protein 1) | EBI-11031416 | 0.35 |
| Q8C767 | Protein phosphatase 1 regulatory subunit 3B (Hepatic glycogen-targeting protein phosphatase 1 regulatory subunit GL) (Protein phosphatase 1 regulatory subunit 4) (PP1 subunit R4) (Protein phosphatase 1 subunit GL) (PTG) | EBI-11064501 | 0.35 |
| Q5HZK1 | Centrosomal protein of 44 kDa (Cep44) | EBI-11074242 | 0.35 |
| G3X972 | Sec24-related gene family, member C (S. cerevisiae) | EBI-11079358 | 0.35 |
| Q16643 | Drebrin (Developmentally-regulated brain protein) | EBI-11080402 | 0.35 |
| Q9NYZ3 | G2 and S phase-expressed protein 1 (GTSE-1) (Protein B99 homolog) | EBI-11081743 | 0.35 |
| Q00610 | Clathrin heavy chain 1 (Clathrin heavy chain on chromosome 17) (CLH-17) | EBI-11082478 | 0.35 |
| Q8BGH2 | Sorting and assembly machinery component 50 homolog | EBI-11097023 | 0.35 |
| P53667 | LIM domain kinase 1 (LIMK-1) (EC 2.7.11.1) | EBI-11101207 | 0.35 |
| P09803 | Cadherin-1 (ARC-1) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) [Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3] | EBI-11106849 | 0.35 |
| Q86X19 | Transmembrane protein 17 | EBI-11390509 | 0.27 |
| Q9HC29 | Nucleotide-binding oligomerization domain-containing protein 2 (Caspase recruitment domain-containing protein 15) (Inflammatory bowel disease protein 1) | EBI-11420226 | 0.66 |
| Q6P5F9 | Exportin-1 (Exp1) (Chromosome region maintenance 1 protein homolog) | EBI-11603310 | 0.35 |
| P03496 | Non-structural protein 1 (NS1) (NS1A) | EBI-11519918 | 0.37 |
| Q2PJP0 | Non-structural protein 1 (NS1) | EBI-11520503 | 0.37 |
| Q6DP93 | Non-structural protein 1 (NS1) | EBI-11520678 | 0.37 |
| P03508 | Nuclear export protein (NEP) (Non-structural protein 2) (NS2) | EBI-11520965 | 0.37 |
| Q20MH4 | Nuclear export protein (NEP) (Non-structural protein 2) (NS2) | EBI-11521170 | 0.37 |
| Q9UQB3 | Catenin delta-2 (Delta-catenin) (GT24) (Neural plakophilin-related ARM-repeat protein) (NPRAP) (Neurojungin) | EBI-11793333 | 0.40 |
| O00192 | Splicing regulator ARVCF (Armadillo repeat protein deleted in velo-cardio-facial syndrome) | EBI-11793379 | 0.40 |
| Q9BY21 | G-protein coupled receptor 87 (G-protein coupled receptor 95) | EBI-11793409 | 0.40 |
| Q96DL1 | NXPE family member 2 (Protein FAM55B) | EBI-11793419 | 0.40 |
| Q8NHY3 | GAS2-like protein 2 (GAS2-related protein on chromosome 17) (Growth arrest-specific protein 2-like 2) | EBI-11793429 | 0.40 |
| A3EX99 | Envelope small membrane protein (E protein) (sM protein) | EBI-11794147 | 0.40 |
| A3EXD5 | Envelope small membrane protein (E protein) (sM protein) | EBI-11794185 | 0.40 |
| P06427 | Protein E6 | EBI-11794195 | 0.40 |
| Q9IDV3 | Protein Vpu (U ORF protein) (Viral protein U) | EBI-11794220 | 0.40 |
| Q1A244 | Protein Vpu (U ORF protein) (Viral protein U) | EBI-11794243 | 0.40 |
| P03126 | Protein E6 | EBI-11794253 | 0.40 |
| P50804 | Protein E6 | EBI-11794263 | 0.40 |
| P0C9G5 | Protein MGF 110-2L | EBI-11794280 | 0.40 |
| A3EXD4 | Non-structural protein 3d (ns3d) (Accessory protein 3d) | EBI-11794297 | 0.40 |
| P89432 | Replication origin-binding protein (OBP) (OriBP) | EBI-11794318 | 0.40 |
| P0C213 | Protein Tax-1 (Protein X-LOR) (Trans-activating transcriptional regulatory protein of HTLV-1) | EBI-11794328 | 0.40 |
| Q18LE1 | Triplex capsid protein 2 | EBI-11794586 | 0.40 |
| Q8IWL3 | Iron-sulfur cluster co-chaperone protein HscB (DnaJ homolog subfamily C member 20) [Cleaved into: Iron-sulfur cluster co-chaperone protein HscB, cytoplasmic (C-HSC20); Iron-sulfur cluster co-chaperone protein HscB, mitochondrial] | EBI-13943458 | 0.35 |
| P62136 | Serine/threonine-protein phosphatase PP1-alpha catalytic subunit (PP-1A) (EC 3.1.3.16) | EBI-14025896 | 0.42 |
| Q96H86 | Zinc finger protein 764 | EBI-21521634 | 0.35 |
| Q7Z398 | Zinc finger protein 550 | EBI-21528160 | 0.35 |
| A8K8V0 | Zinc finger protein 785 | EBI-21612043 | 0.35 |
| P09017 | Homeobox protein Hox-C4 (Homeobox protein CP19) (Homeobox protein Hox-3E) | EBI-21634836 | 0.35 |
| Q8IZ69 | tRNA (uracil-5-)-methyltransferase homolog A (EC 2.1.1.35) (mRNA (uracil-5-)-methyltransferase TRMT2A) (EC 2.1.1.-) | EBI-21636338 | 0.35 |
| Q8WV44 | E3 ubiquitin-protein ligase TRIM41 (EC 2.3.2.27) (RING finger-interacting protein with C kinase) (RINCK) (Tripartite motif-containing protein 41) | EBI-21636495 | 0.35 |
| Q96IQ9 | Zinc finger protein 414 | EBI-21636586 | 0.35 |
| Q9H9D4 | Zinc finger protein 408 (PR domain zinc finger protein 17) | EBI-21642543 | 0.35 |
| O43296 | Zinc finger protein 264 | EBI-21725229 | 0.35 |
| Q49MI3 | Ceramide kinase-like protein | EBI-21731388 | 0.35 |
| P43235 | Cathepsin K (EC 3.4.22.38) (Cathepsin O) (Cathepsin O2) (Cathepsin X) | EBI-21781359 | 0.35 |
| Q8TA94 | Zinc finger protein 563 | EBI-21783979 | 0.35 |
| Q9NY56 | Odorant-binding protein 2a (Odorant-binding protein IIa) (OBPIIa) | EBI-21795463 | 0.35 |
| Q6ZMY9 | Zinc finger protein 517 | EBI-21818150 | 0.35 |
| P20160 | Azurocidin (Cationic antimicrobial protein CAP37) (Heparin-binding protein) (HBP) (hHBP) | EBI-21867396 | 0.35 |
| Q14CB8 | Rho GTPase-activating protein 19 (Rho-type GTPase-activating protein 19) | EBI-21871748 | 0.35 |
| Q9P0T4 | Zinc finger protein 581 | EBI-21882203 | 0.35 |
| P15311 | Ezrin (Cytovillin) (Villin-2) (p81) | EBI-16791848 | 0.27 |
| P49841 | Glycogen synthase kinase-3 beta (GSK-3 beta) (EC 2.7.11.26) (Serine/threonine-protein kinase GSK3B) (EC 2.7.11.1) | EBI-16793176 | 0.27 |
| P11279 | Lysosome-associated membrane glycoprotein 1 (LAMP-1) (Lysosome-associated membrane protein 1) (CD107 antigen-like family member A) (CD antigen CD107a) | EBI-16795491 | 0.27 |
| Q9NPJ6 | Mediator of RNA polymerase II transcription subunit 4 (Activator-recruited cofactor 36 kDa component) (ARC36) (Mediator complex subunit 4) (TRAP/SMCC/PC2 subunit p36 subunit) (Vitamin D3 receptor-interacting protein complex 36 kDa component) (DRIP36) | EBI-25472202 | 0.27 |
| P03372 | Estrogen receptor (ER) (ER-alpha) (Estradiol receptor) (Nuclear receptor subfamily 3 group A member 1) | EBI-21301141 | 0.35 |
| Q2LC84 | Protein numb homolog | EBI-22258042 | 0.35 |
| Q04970 | GTPase NRas (EC 3.6.5.2) (Transforming protein N-Ras) | EBI-22258042 | 0.35 |
| P60868 | 40S ribosomal protein S20 | EBI-22258042 | 0.35 |
| A0A0G2K8Z9 | Kinesin family member 13B | EBI-22258042 | 0.35 |
| G3V7V7 | Insulin receptor substrate 1 | EBI-22258042 | 0.35 |
| D4A9L2 | Serine/arginine-rich splicing factor 1 (Splicing factor, arginine/serine-rich 1) | EBI-22258042 | 0.35 |
| A0A0G2K654 | H1.2 linker histone, cluster member (RCG45246) | EBI-22258042 | 0.35 |
| Q27W01 | RNA-binding protein 8A (RNA-binding motif protein 8A) (Ribonucleoprotein RBM8A) | EBI-22258042 | 0.35 |
| B2RYP6 | LUC7-like 2 (S. cerevisiae) (LUC7-like 2 (S. cerevisiae) (Predicted)) | EBI-22258042 | 0.35 |
| G3V6S1 | PRKC apoptosis WT1 regulator protein | EBI-22258042 | 0.35 |
| P62890 | 60S ribosomal protein L30 | EBI-22258042 | 0.35 |
| P35427 | 60S ribosomal protein L13a | EBI-22258042 | 0.35 |
| Q8K1Q0 | Glycylpeptide N-tetradecanoyltransferase 1 (EC 2.3.1.97) (Myristoyl-CoA:protein N-myristoyltransferase 1) (NMT 1) (Type I N-myristoyltransferase) (Peptide N-myristoyltransferase 1) | EBI-22258042 | 0.35 |
| B5DFM8 | Pre-mRNA-splicing factor SPF27 | EBI-22258042 | 0.35 |
| Q6AYK8 | Eukaryotic translation initiation factor 3 subunit D (eIF3d) (Eukaryotic translation initiation factor 3 subunit 7) (eIF-3-zeta) | EBI-22258042 | 0.35 |
| Q4V8C8 | Parafibromin (Cell division cycle protein 73 homolog) (Hyperparathyroidism 2 protein homolog) | EBI-22258042 | 0.35 |
| Q920F5 | Malonyl-CoA decarboxylase, mitochondrial (MCD) (EC 4.1.1.9) | EBI-22258042 | 0.35 |
| D4A3K5 | Histone H1.1 (Histone H1a) | EBI-22258042 | 0.35 |
| E9PT65 | Radixin | EBI-22258042 | 0.35 |
| P62850 | 40S ribosomal protein S24 | EBI-22258042 | 0.35 |
| G3V9L1 | Testis expressed gene 2 (Testis-expressed 2) (Tex2) | EBI-22258042 | 0.35 |
| M0R6J0 | Mitochondrial ribosomal protein L39 (RCG58784, isoform CRA_a) | EBI-22258042 | 0.35 |
| P62278 | 40S ribosomal protein S13 | EBI-22258042 | 0.35 |
| Q6IMY8 | Heterogeneous nuclear ribonucleoprotein U (hnRNP U) (SP120) (Scaffold-attachment factor A) (SAF-A) | EBI-22258042 | 0.35 |
| Q62780 | Probable ATP-dependent RNA helicase DDX46 (EC 3.6.4.13) (DEAD box protein 46) (Helicase of 117.4 kDa) | EBI-22258042 | 0.35 |
| P24368 | Peptidyl-prolyl cis-trans isomerase B (PPIase B) (EC 5.2.1.8) (CYP-S1) (Cyclophilin B) (Rotamase B) (S-cyclophilin) (SCYLP) | EBI-22258042 | 0.35 |
| A0A0G2K719 | RNA helicase (EC 3.6.4.13) | EBI-22258042 | 0.35 |
| Q7TT49 | Serine/threonine-protein kinase MRCK beta (EC 2.7.11.1) (CDC42-binding protein kinase beta) (DMPK-like beta) (Myotonic dystrophy kinase-related CDC42-binding kinase beta) (MRCK beta) (Myotonic dystrophy protein kinase-like beta) | EBI-22258042 | 0.35 |
| P09875 | UDP-glucuronosyltransferase 2B1 (UDPGT 2B1) (UGT2B1) (EC 2.4.1.17) (UDPGTr-2) | EBI-22258042 | 0.35 |
| P09895 | 60S ribosomal protein L5 | EBI-22258042 | 0.35 |
| P62893 | 60S ribosomal protein L39 | EBI-22258042 | 0.35 |
| Q9R0T3 | DnaJ homolog subfamily C member 3 (Interferon-induced, double-stranded RNA-activated protein kinase inhibitor) (Protein kinase inhibitor of 58 kDa) (Protein kinase inhibitor p58) | EBI-22258042 | 0.35 |
| A0A0G2JW88 | Microtubule-associated protein | EBI-22258042 | 0.35 |
| M0R9L3 | Sorting nexin | EBI-22258042 | 0.35 |
| Q5RK00 | 39S ribosomal protein L46, mitochondrial (L46mt) (MRP-L46) | EBI-22258042 | 0.35 |
| E9PU01 | DNA helicase (EC 3.6.4.12) | EBI-22258042 | 0.35 |
| Q3KRF2 | High density lipoprotein binding protein (Vigilin) (High density lipoprotein binding protein, isoform CRA_c) (Vigilin) | EBI-22258042 | 0.35 |
| F1M124 | Cordon-bleu WH2 repeat protein-like 1 | EBI-22258042 | 0.35 |
| D3ZZT9 | Collagen type XIV alpha 1 chain | EBI-22258042 | 0.35 |
| Q9JJ31 | Cullin-5 (CUL-5) (Vasopressin-activated calcium-mobilizing receptor 1) (VACM-1) | EBI-22258042 | 0.35 |
| Q63186 | Translation initiation factor eIF-2B subunit delta (eIF-2B GDP-GTP exchange factor subunit delta) | EBI-22258042 | 0.35 |
| P17078 | 60S ribosomal protein L35 | EBI-22258042 | 0.35 |
| P13471 | 40S ribosomal protein S14 | EBI-22258042 | 0.35 |
| F1MAF2 | A-kinase-anchoring protein 17A | EBI-22258042 | 0.35 |
| Q6AYE2 | Endophilin-B1 (SH3 domain-containing GRB2-like protein B1) | EBI-22258042 | 0.35 |
| D4AD15 | Eukaryotic translation initiation factor 4 gamma 1 | EBI-22258042 | 0.35 |
| P50904 | Ras GTPase-activating protein 1 (GAP) (GTPase-activating protein) (RasGAP) (Ras p21 protein activator) (p120GAP) | EBI-22258042 | 0.35 |
| B2GV09 | Llgl2 protein | EBI-22258042 | 0.35 |
| P05197 | Elongation factor 2 (EF-2) | EBI-22258042 | 0.35 |
| G3V9N7 | Protein kinase C and casein kinase substrate in neurons 3 (RCG27172, isoform CRA_a) | EBI-22258042 | 0.35 |
| P62961 | Y-box-binding protein 1 (YB-1) (Enhancer factor I subunit A) (EFI-A) (Nuclease-sensitive element-binding protein 1) (Y-box transcription factor) | EBI-22258042 | 0.35 |
| A0A096MK30 | Moesin | EBI-22258042 | 0.35 |
| D4A4R1 | EMAP-like 3 (RCG48622, isoform CRA_a) | EBI-22258042 | 0.35 |
| P30009 | Myristoylated alanine-rich C-kinase substrate (MARCKS) (Protein kinase C substrate 80 kDa protein) | EBI-22258042 | 0.35 |
| Q5M7V8 | Thyroid hormone receptor-associated protein 3 (Thyroid hormone receptor-associated protein complex 150 kDa component) (Trap150) | EBI-22258042 | 0.35 |
| P47198 | 60S ribosomal protein L22 | EBI-22258042 | 0.35 |
| P31000 | Vimentin | EBI-22258042 | 0.35 |
| P61314 | 60S ribosomal protein L15 | EBI-22258042 | 0.35 |
| D3Z898 | Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 | EBI-22258042 | 0.35 |
| Q5U2Q7 | Eukaryotic peptide chain release factor subunit 1 (Eukaryotic release factor 1) (eRF1) | EBI-22258042 | 0.35 |
| Q5XIM5 | Protein CDV3 homolog | EBI-22258042 | 0.35 |
| P13086 | Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial (EC 6.2.1.4) (EC 6.2.1.5) (Succinyl-CoA synthetase subunit alpha) (SCS-alpha) | EBI-22258042 | 0.35 |
| Q5M963 | N-acylneuraminate cytidylyltransferase (EC 2.7.7.43) (CMP-N-acetylneuraminic acid synthase) | EBI-22258042 | 0.35 |
| P81795 | Eukaryotic translation initiation factor 2 subunit 3, X-linked (EC 3.6.5.3) (Eukaryotic translation initiation factor 2 subunit gamma, X-linked) (eIF-2-gamma) (eIF-2-gamma X) (PP42) | EBI-22258042 | 0.35 |
| M0R9T2 | Erbb2-interacting protein | EBI-22258042 | 0.35 |
| P41743 | Protein kinase C iota type (EC 2.7.11.13) (Atypical protein kinase C-lambda/iota) (PRKC-lambda/iota) (aPKC-lambda/iota) (nPKC-iota) | EBI-25380638 | 0.35 |
| P0DOF2 | Matrix protein (Phosphoprotein M2) | EBI-25603126 | 0.35 |
| K9N5R3 | Envelope small membrane protein (E protein) (sM protein) | EBI-26973414 | 0.40 |
| F1PAA9 | Cadherin-1 (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) [Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3] | EBI-27079701 | 0.27 |
| A0A0H3NFP4 | SPI-2 type III secretion system effector SifA (Type III secretion system effector protein-necessary for Sif formation and maintaining the SCV. Has GAP activity) | EBI-27055788 | 0.27 |
| P13569 | Cystic fibrosis transmembrane conductance regulator (CFTR) (ATP-binding cassette sub-family C member 7) (Channel conductance-controlling ATPase) (EC 5.6.1.6) (cAMP-dependent chloride channel) | EBI-27087549 | 0.35 |
| Q99592 | Zinc finger and BTB domain-containing protein 18 (58 kDa repressor protein) (Transcriptional repressor RP58) (Translin-associated zinc finger protein 1) (TAZ-1) (Zinc finger protein 238) (Zinc finger protein C2H2-171) | EBI-27093179 | 0.35 |
| Q92630 | Dual specificity tyrosine-phosphorylation-regulated kinase 2 (EC 2.7.12.1) | EBI-28952324 | 0.27 |
| Q13886 | Krueppel-like factor 9 (Basic transcription element-binding protein 1) (BTE-binding protein 1) (GC-box-binding protein 1) (Transcription factor BTEB1) | EBI-29000705 | 0.35 |
| P30530 | Tyrosine-protein kinase receptor UFO (EC 2.7.10.1) (AXL oncogene) | EBI-32717503 | 0.35 |
| P29317 | Ephrin type-A receptor 2 (EC 2.7.10.1) (Epithelial cell kinase) (Tyrosine-protein kinase receptor ECK) | EBI-32720711 | 0.27 |
| P29320 | Ephrin type-A receptor 3 (EC 2.7.10.1) (EPH-like kinase 4) (EK4) (hEK4) (HEK) (Human embryo kinase) (Tyrosine-protein kinase TYRO4) (Tyrosine-protein kinase receptor ETK1) (Eph-like tyrosine kinase 1) | EBI-32720767 | 0.27 |
| P54764 | Ephrin type-A receptor 4 (EC 2.7.10.1) (EPH-like kinase 8) (EK8) (hEK8) (Tyrosine-protein kinase TYRO1) (Tyrosine-protein kinase receptor SEK) | EBI-32720816 | 0.27 |
| P54756 | Ephrin type-A receptor 5 (EC 2.7.10.1) (Brain-specific kinase) (EPH homology kinase 1) (EHK-1) (EPH-like kinase 7) (EK7) (hEK7) | EBI-32720907 | 0.27 |
| Q15375 | Ephrin type-A receptor 7 (EC 2.7.10.1) (EPH homology kinase 3) (EHK-3) (EPH-like kinase 11) (EK11) (hEK11) | EBI-32721052 | 0.27 |
| P21802 | Fibroblast growth factor receptor 2 (FGFR-2) (EC 2.7.10.1) (K-sam) (KGFR) (Keratinocyte growth factor receptor) (CD antigen CD332) | EBI-32721907 | 0.27 |
| P22455 | Fibroblast growth factor receptor 4 (FGFR-4) (EC 2.7.10.1) (CD antigen CD334) | EBI-32722168 | 0.27 |
| Q06124 | Tyrosine-protein phosphatase non-receptor type 11 (EC 3.1.3.48) (Protein-tyrosine phosphatase 1D) (PTP-1D) (Protein-tyrosine phosphatase 2C) (PTP-2C) (SH-PTP2) (SHP-2) (Shp2) (SH-PTP3) | EBI-32723738 | 0.27 |
| Q16288 | NT-3 growth factor receptor (EC 2.7.10.1) (GP145-TrkC) (Trk-C) (Neurotrophic tyrosine kinase receptor type 3) (TrkC tyrosine kinase) | EBI-32724526 | 0.27 |
| P16234 | Platelet-derived growth factor receptor alpha (PDGF-R-alpha) (PDGFR-alpha) (EC 2.7.10.1) (Alpha platelet-derived growth factor receptor) (Alpha-type platelet-derived growth factor receptor) (CD140 antigen-like family member A) (CD140a antigen) (Platelet-derived growth factor alpha receptor) (Platelet-derived growth factor receptor 2) (PDGFR-2) (CD antigen CD140a) | EBI-32724889 | 0.27 |
| Q01973 | Inactive tyrosine-protein kinase transmembrane receptor ROR1 (Neurotrophic tyrosine kinase, receptor-related 1) | EBI-32725295 | 0.27 |
| Q6J9G0 | Tyrosine-protein kinase STYK1 (EC 2.7.10.2) (Novel oncogene with kinase domain) (Protein PK-unique) (Serine/threonine/tyrosine kinase 1) | EBI-32731895 | 0.27 |
| P12830 | Cadherin-1 (CAM 120/80) (Epithelial cadherin) (E-cadherin) (Uvomorulin) (CD antigen CD324) [Cleaved into: E-Cad/CTF1; E-Cad/CTF2; E-Cad/CTF3] | EBI-34580821 | 0.35 |
Database | Links |
| UNIPROT | Q96RT1 A0AVR1 B4E3F1 B7ZLV9 E7EQW9 E9PCR8 Q1RMD0 Q86W38 Q9NR18 Q9NW48 Q9ULJ5 |
| PDB | 1MFG 1MFL 1N7T 2H3L 2QBW 3CH8 6Q0M 6Q0N 6Q0U 6UBH 7LUL |
| Pfam | PF13855 PF00595 |
| PROSITE | PS51450 PS50106 |
| OMIM | 606944 |
| DisGeNET | 55914 |
National and Kapodistrian University of Athens
Department of Biology
Biophysics & Bioinformatics Laboratory