HCLS1-associated protein X-1 - Homo sapiens

HCLS1-associated protein X-1 (Homo sapiens)

FASTA TEXT XML

Subcellular Location Biology & Function Disease Associations Interactions Cross-References

General Information

Protein Information
Protein Name	HCLS1-associated protein X-1
Accession Code	O00165
Gene	HAX1
Organism	Homo sapiens \| Human (Taxonomy: 9606)
Part of Reference Proteome?	Yes
Sequence (Length: 279)
MSLFDLFRGFFGFPGPRSHRDPFFGGMTRDEDDDEEEEEEGGSWGRGNPRFHSPQHPPEEFGFGFSFSPGGGIRFHDNFGFDDLVRDFNSIFSDMGAWTLPSHPPELPGPESETPGERLREGQTLRDSML KYPDSHQPRIFGGVLESDARSESPQPAPDWGSQRPFHRFDDVWPMDPHPRTREDNDLDSQVSQEGLGPVLQPQPKSYFKSISVTKITKPDGIVEERRTVVDSEGRTETTVTRHEADSSPRGDPESPRPPA LDDAFSILDLFLGRWFRSR

Subcellular Location

Description
Mitochondrion {Experimental EvidencePubMed:18971376, Experimental EvidencePubMed:9058808}. Endoplasmic reticulum {Experimental EvidencePubMed:18971376, Experimental EvidencePubMed:9058808}. Nucleus membrane {Experimental EvidencePubMed:9058808}. Cytoplasmic vesicle {By SimilarityUniProtKB:O35387}. Cytoplasm, cell cortex {Experimental EvidencePubMed:26997484}. Cell membrane {Experimental EvidencePubMed:26997484}; Peripheral membrane protein {Experimental EvidencePubMed:26997484}; Cytoplasmic side {Experimental EvidencePubMed:26997484}. Sarcoplasmic reticulum {ECO:0000250\|UniProtKB:Q7TSE9}. Cytoplasm, P-body {ECO:0000269\|PubMed:23164465}. [Isoform 1]: Cytoplasm {ECO:0000269\|PubMed:23164465, ECO:0000269\|PubMed:25298122}. Nucleus {ECO:0000269\|PubMed:23164465}. Note=Predominantly cytoplasmic. Also detected in the nucleus when nuclear export is inhibited, and in response to cellular stress caused by arsenite (in vitro). {ECO:0000269\|PubMed:23164465}. [Isoform 3]: Cytoplasm {ECO:0000269\|PubMed:23164465}. Nucleus {ECO:0000269\|PubMed:23164465}. Note=Predominantly cytoplasmic. Also detected in the nucleus when nuclear export is inhibited (in vitro). {ECO:0000269\|PubMed:23164465}. [Isoform 4]: Cytoplasm {ECO:0000269\|PubMed:23164465}. Nucleus {ECO:0000269\|PubMed:23164465}. Note=Shuttles between nucleus and cytoplasm. {ECO:0000269\|PubMed:23164465}. [Isoform 5]: Cytoplasm {ECO:0000269\|PubMed:23164465}. Note=Predominantly cytoplasmic. {ECO:0000269\|PubMed:23164465}.
Position in the Nuclear Envelope
Location	Location ID	Description
Nuclear Envelope	SL-0178	The nuclear envelope is a membrane system which surrounds the nucleoplasm of eukaryotic cells. It is composed of the nuclear lamina, nuclear pore complexes and two nuclear membranes. The space between the two membranes is called the nuclear intermembrane space.
Nuclear Membrane	SL-0182	The membrane surrounding the nucleus. This term is used when it is not known if the protein is found in or associated with the inner or outer nuclear membrane.
Membrane Topology
Topology	Source	Annotation Type
Peripheral	UniProt	Experimental Evidence {ECO:0000269\|PubMed:26997484}
Assigned Ontology terms

Cellular Component	Actin Cytoskeleton (GO:0015629) Apical Plasma Membrane (GO:0016324) Cell Cortex (GO:0005938) Clathrin-Coated Vesicle (GO:0030136) Endoplasmic Reticulum (GO:0005783) Lamellipodium (GO:0030027) Mitochondrial Intermembrane Space (GO:0005758) Mitochondrial Outer Membrane (GO:0005741) Mitochondrion (GO:0005739) Nuclear Envelope (GO:0005635) Nuclear Membrane (GO:0031965) P-Body (GO:0000932) Sarcoplasmic Reticulum (GO:0016529) Transcription Regulator Complex (GO:0005667)

Biology & Function

Description
Recruits the Arp2/3 complex to the cell cortex and regulates reorganization of the cortical actin cytoskeleton via its interaction with KCNC3 and the Arp2/3 complex (PubMed:26997484). Slows down the rate of inactivation of KCNC3 channels (PubMed:26997484). Promotes GNA13-mediated cell migration. Involved in the clathrin-mediated endocytosis pathway. May be involved in internalization of ABC transporters such as ABCB11. May inhibit CASP9 and CASP3. Promotes cell survival. May regulate intracellular calcium pools. {Experimental EvidencePubMed:15339924, Experimental EvidencePubMed:16857965, Experimental EvidencePubMed:17545607, Experimental EvidencePubMed:18319618, Experimental EvidencePubMed:18971376, Experimental EvidencePubMed:26997484, Experimental EvidencePubMed:9058808}.
Assigned Ontology terms

Biological Process	Cellular Response To Cytokine Stimulus (GO:0071345) Negative Regulation Of Apoptotic Process (GO:0043066) Positive Regulation Of Actin Cytoskeleton Reorganization (GO:2000251) Positive Regulation Of Granulocyte Differentiation (GO:0030854) Positive Regulation Of Peptidyl-Serine Phosphorylation (GO:0033138) Positive Regulation Of Peptidyl-Tyrosine Phosphorylation (GO:0050731) Positive Regulation Of Phosphatidylinositol 3-Kinase Signaling (GO:0014068) Positive Regulation Of Protein Kinase B Signaling (GO:0051897) Positive Regulation Of Transcription By RNA Polymerase II (GO:0045944) Regulation Of Actin Filament Polymerization (GO:0030833) Regulation Of Apoptotic Process (GO:0042981) Regulation Of Autophagy Of Mitochondrion (GO:1903146) Regulation Of Protein Targeting To Mitochondrion (GO:1903214)
Molecular Function	Interleukin-1 Binding (GO:0019966) Protein N-Terminus Binding (GO:0047485)

Disease associations

Description
Neutropenia, severe congenital 3, autosomal recessive (SCN3) [MIM:610738]: A disorder of hematopoiesis characterized by maturation arrest of granulopoiesis at the level of promyelocytes with peripheral blood absolute neutrophil counts below 0.5 x 10(9)/l and early onset of severe bacterial infections. Some patients affected by severe congenital neutropenia type 3 have neurological manifestations such as psychomotor retardation and seizures. {Experimental EvidencePubMed:17187068, Experimental EvidencePubMed:18337561, Experimental EvidencePubMed:19796188, Experimental EvidencePubMed:20220065}. Note=The disease is caused by variants affecting the gene represented in this entry. The clinical phenotype due to HAX1 deficiency appears to depend on the localization of the mutations and their influence on the transcript variants. Mutations affecting exclusively isoform 1 are associated with isolated congenital neutropenia, whereas mutations affecting both isoform 1 and isoform 5 are associated with additional neurologic symptoms (PubMed:18337561). {Experimental EvidencePubMed:18337561}.
Database Associations
OMIM	605998 610738
DisGeNET	10456

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (8 interactors)

Partner (NucEnvDB)		IntAct	Confidence score
A0A142I5B9	RNA-directed RNA polymerase NS5	EBI-20626314	0.35
O43542	DNA repair protein XRCC3	EBI-11129266	0.35
Q92993	Histone acetyltransferase KAT5	EBI-25912324	0.56
P53671	LIM domain kinase 2	EBI-28938453	0.35
Q6P5Z2	Serine/threonine-protein kinase N3	EBI-28941754	0.35
O95831	Apoptosis-inducing factor 1, mitochondrial	EBI-16786283	0.42
O95476	CTD nuclear envelope phosphatase 1	EBI-27113178	0.35
P04626	Receptor tyrosine-protein kinase erbB-2	EBI-32718334	0.35
Interactions with other proteins (216 interactors)

Partner (UniProt)		IntAct	Confidence score
Q99759	Mitogen-activated protein kinase kinase kinase 3 (EC 2.7.11.25) (MAPK/ERK kinase kinase 3) (MEK kinase 3) (MEKK 3)	EBI-362136	0.00
Q04206	Transcription factor p65 (Nuclear factor NF-kappa-B p65 subunit) (Nuclear factor of kappa light polypeptide gene enhancer in B-cells 3)	EBI-363244	0.00
P19438	Tumor necrosis factor receptor superfamily member 1A (Tumor necrosis factor receptor 1) (TNF-R1) (Tumor necrosis factor receptor type I) (TNF-RI) (TNFR-I) (p55) (p60) (CD antigen CD120a) [Cleaved into: Tumor necrosis factor receptor superfamily member 1A, membrane form; Tumor necrosis factor-binding protein 1 (TBPI)]	EBI-364357	0.00
P20333	Tumor necrosis factor receptor superfamily member 1B (Tumor necrosis factor receptor 2) (TNF-R2) (Tumor necrosis factor receptor type II) (TNF-RII) (TNFR-II) (p75) (p80 TNF-alpha receptor) (CD antigen CD120b) (Etanercept) [Cleaved into: Tumor necrosis factor receptor superfamily member 1b, membrane form; Tumor necrosis factor-binding protein 2 (TBP-2) (TBPII)]	EBI-364585	0.00
Q16760	Diacylglycerol kinase delta (DAG kinase delta) (EC 2.7.1.107) (130 kDa diacylglycerol kinase) (Diglyceride kinase delta) (DGK-delta)	EBI-734287	0.00
O12160	Protein Vpr (R ORF protein) (Viral protein R)	EBI-7845312	0.64
O00303	Eukaryotic translation initiation factor 3 subunit F (eIF3f) (Deubiquitinating enzyme eIF3f) (EC 3.4.19.12) (Eukaryotic translation initiation factor 3 subunit 5) (eIF-3-epsilon) (eIF3 p47)	EBI-758371	0.37
O70127	Bile salt export pump (EC 7.6.2.-) (ATP-binding cassette sub-family B member 11) (Sister of P-glycoprotein)	EBI-930216	0.40
Q6PSM0	Multidrug resistance protein 1a	EBI-930234	0.40
Q15714	TSC22 domain family protein 1 (Cerebral protein 2) (Regulatory protein TSC-22) (TGFB-stimulated clone 22 homolog) (Transforming growth factor beta-1-induced transcript 4 protein)	EBI-1085974	0.00
P13569	Cystic fibrosis transmembrane conductance regulator (CFTR) (ATP-binding cassette sub-family C member 7) (Channel conductance-controlling ATPase) (EC 5.6.1.6) (cAMP-dependent chloride channel)	EBI-1171360	0.35
Q8AZK7	Epstein-Barr nuclear antigen leader protein (EBNA-LP) (EBV nuclear antigen leader protein) (Epstein-Barr nuclear antigen 5) (EBNA-5) (EBV nuclear antigen 5)	EBI-9632715	0.53
O46385	Supervillin (Archvillin) (p205/p250)	EBI-7874199	0.27
Q5NE99	Protein-export protein SecB 2	EBI-2806387	0.00
Q5NFJ2	Exported protein	EBI-2806394	0.00
A0A0F7R9R7	Wall-Associated protein	EBI-2811156	0.00
Q81VT8	DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (EC 2.7.7.6) (RNA polymerase subunit beta) (Transcriptase subunit beta)	EBI-2811888	0.00
A0A6L7HRI8	Efflux RND transporter periplasmic adaptor subunit	EBI-2813096	0.00
Q81M67	Probable butyrate kinase (BK) (EC 2.7.2.7) (Branched-chain carboxylic acid kinase)	EBI-2816763	0.00
A0A2P0H993	Aminopeptidase AmpS (EC 3.4.11.-)	EBI-2816781	0.00
A0A6H3ACS9	DUF2154 domain-containing protein	EBI-2832676	0.00
Q81SR4	UPF0398 protein BA_1582/GBAA_1582/BAS1466	EBI-2832662	0.00
A0A4Y1WB04	DUF1232 domain-containing protein	EBI-2832641	0.00
A0A6L8PU14	YceG_bac domain-containing protein	EBI-2832669	0.00
Q81KV7	Argininosuccinate synthase (EC 6.3.4.5) (Citrulline--aspartate ligase)	EBI-2832655	0.00
Q81WU4	Peptidase T (EC 3.4.11.4) (Aminotripeptidase) (Tripeptidase) (Tripeptide aminopeptidase)	EBI-2832648	0.00
A0A6L7HHZ0	Beta-lactam antibiotic acylase family protein	EBI-2832709	0.00
A0A6L7H2Q9	MutT/nudix family protein	EBI-2832690	0.00
A0A6L7H5N1	Conserved repeat domain protein	EBI-2832683	0.00
A0A6L7HH25	Putative penicillin-binding protein	EBI-2832697	0.00
A0A0J1KLZ7	Transposase	EBI-2832716	0.00
A0A6H3AND8	Acetyl-CoA acetyltransferase	EBI-2832723	0.00
A0A380PD11	Uncharacterized protein	EBI-2840043	0.00
A0A3N4AYP8	PTS system, phosphocarrier protein	EBI-2843166	0.00
A0A3G5LD16	Fe-S cluster assembly protein SufD (Putative membrane components of an uncharacterized iron-regulated ABC-type transporter SufB)	EBI-2843155	0.00
A0A380PL54	Phosphoserine phosphatase (EC 3.1.3.3) (O-phosphoserine phosphohydrolase)	EBI-2847491	0.00
A0A380PNP6	Putative DEAD box helicase family protein	EBI-2847479	0.00
Q8CLE0	Hcp1 family type VI secretion system effector	EBI-2868346	0.00
Q8CZR2	GFO_IDH_MocA domain-containing protein	EBI-2868335	0.00
Q8D014	Ribonucleoside-diphosphate reductase (EC 1.17.4.1)	EBI-2868325	0.00
A0A5P8YFI0	Putative hemolysin	EBI-2868386	0.00
A0A380PFG3	Putative aminotransferase	EBI-2868379	0.00
Q8CKN6	Putative exported protein	EBI-2868353	0.00
A0A5P8YJT1	Flagellar motor switch protein FliG	EBI-2868365	0.00
A0A5P8YBY1	Anaerobic ribonucleoside-triphosphate reductase (EC 1.17.4.2)	EBI-2868372	0.00
Q7CG77	Na(+)/H(+) antiporter NhaA (Sodium/proton antiporter NhaA)	EBI-2868393	0.00
Q8ZBU3	S-ribosylhomocysteine lyase (EC 4.4.1.21) (AI-2 synthesis protein) (Autoinducer-2 production protein LuxS)	EBI-2868430	0.00
Q7ARD3	Transcriptional regulator	EBI-2868400	0.00
Q8ZHF4	dITP/XTP pyrophosphatase (EC 3.6.1.66) (Non-canonical purine NTP pyrophosphatase) (Non-standard purine NTP pyrophosphatase) (Nucleoside-triphosphate diphosphatase) (Nucleoside-triphosphate pyrophosphatase) (NTPase)	EBI-2868407	0.00
Q8ZCH3	Sialic acid transporter NanT (Sialic acid permease) (Sialic acid/H(+) symporter)	EBI-2868418	0.00
P69961	Low calcium response locus protein S	EBI-2868442	0.00
Q8ZIY3	Chaperonin GroEL (EC 5.6.1.7) (60 kDa chaperonin) (Chaperonin-60) (Cpn60)	EBI-2868449	0.00
Q8ZDX4	Vitamin B12 import system permease protein BtuC	EBI-2868456	0.00
P03372	Estrogen receptor (ER) (ER-alpha) (Estradiol receptor) (Nuclear receptor subfamily 3 group A member 1)	EBI-3895734	0.53
P48454	Serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform (EC 3.1.3.16) (CAM-PRP catalytic subunit) (Calcineurin, testis-specific catalytic subunit) (Calmodulin-dependent calcineurin A subunit gamma isoform)	EBI-3935613	0.37
P51692	Signal transducer and activator of transcription 5B	EBI-3935643	0.37
P53779	Mitogen-activated protein kinase 10 (MAP kinase 10) (MAPK 10) (EC 2.7.11.24) (MAP kinase p49 3F12) (Stress-activated protein kinase 1b) (SAPK1b) (Stress-activated protein kinase JNK3) (c-Jun N-terminal kinase 3)	EBI-3935623	0.55
P27694	Replication protein A 70 kDa DNA-binding subunit (RP-A p70) (Replication factor A protein 1) (RF-A protein 1) (Single-stranded DNA-binding protein) [Cleaved into: Replication protein A 70 kDa DNA-binding subunit, N-terminally processed]	EBI-3935633	0.37
P62877	E3 ubiquitin-protein ligase RBX1 (EC 2.3.2.27) (EC 2.3.2.32) (E3 ubiquitin-protein transferase RBX1) (Protein ZYP) (RING finger protein 75) (RING-box protein 1) (Rbx1) (Regulator of cullins 1) (ROC1) [Cleaved into: E3 ubiquitin-protein ligase RBX1, N-terminally processed (E3 ubiquitin-protein transferase RBX1, N-terminally processed)]	EBI-3935653	0.37
Q9P1U0	DNA-directed RNA polymerase I subunit RPA12 (DNA-directed RNA polymerase I subunit H) (Zinc ribbon domain-containing protein 1)	EBI-3941813	0.37
P0DPB6	DNA-directed RNA polymerases I and III subunit RPAC2 (RNA polymerases I and III subunit AC2) (AC19) (DNA-directed RNA polymerase I subunit D) (RNA polymerase I 16 kDa subunit) (RPA16) (RPC16) (hRPA19)	EBI-3941823	0.37
Q8TAQ5	Zinc finger protein 420	EBI-3943650	0.37
Q14451	Growth factor receptor-bound protein 7 (B47) (Epidermal growth factor receptor GRB-7) (GRB7 adapter protein)	EBI-4288461	0.51
P0DOE9	Non-structural protein 1 (NS1) (Non-structural protein 1C)	EBI-6138583	0.35
Q8JPQ9	Non-structural protein NS-S	EBI-6159460	0.35
Q77M19	V protein	EBI-6268389	0.35
Q86Z02	Homeodomain-interacting protein kinase 1 (EC 2.7.11.1) (Nuclear body-associated kinase 2)	EBI-6381086	0.35
O14980	Exportin-1 (Exp1) (Chromosome region maintenance 1 protein homolog)	EBI-8162190	0.40
Q9NPI6	mRNA-decapping enzyme 1A (EC 3.6.1.62) (Smad4-interacting transcriptional co-activator) (Transcription factor SMIF)	EBI-8162243	0.27
Q13619	Cullin-4A (CUL-4A)	EBI-21324822	0.35
Q13618	Cullin-3 (CUL-3)	EBI-21329068	0.35
Q8NHX9	Two pore channel protein 2 (Two pore calcium channel protein 2)	EBI-8817387	0.59
Q9ULQ1	Two pore channel protein 1 (Two pore calcium channel protein 1) (Voltage-dependent calcium channel protein TPC1)	EBI-8817427	0.53
Q8TE30	RNA-directed DNA polymerase (EC 2.7.7.49)	EBI-8874742	0.35
P42858	Huntingtin (Huntington disease protein) (HD protein) [Cleaved into: Huntingtin, myristoylated N-terminal fragment]	EBI-9054212	0.67
P58340	Myeloid leukemia factor 1 (Myelodysplasia-myeloid leukemia factor 1)	EBI-9358437	0.40
Q8K2C9	Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 3 (EC 4.2.1.134) (3-hydroxyacyl-CoA dehydratase 3) (HACD3) (Butyrate-induced protein 1) (B-ind1) (Protein-tyrosine phosphatase-like A domain-containing protein 1)	EBI-9358459	0.40
Q13200	26S proteasome non-ATPase regulatory subunit 2 (26S proteasome regulatory subunit RPN1) (26S proteasome regulatory subunit S2) (26S proteasome subunit p97) (Protein 55.11) (Tumor necrosis factor type 1 receptor-associated protein 2)	EBI-9358502	0.40
Q15773	Myeloid leukemia factor 2 (Myelodysplasia-myeloid leukemia factor 2)	EBI-9358480	0.40
Q16659	Mitogen-activated protein kinase 6 (MAP kinase 6) (MAPK 6) (EC 2.7.11.24) (Extracellular signal-regulated kinase 3) (ERK-3) (MAP kinase isoform p97) (p97-MAPK)	EBI-12502733	0.35
P57078	Receptor-interacting serine/threonine-protein kinase 4 (EC 2.7.11.1) (Ankyrin repeat domain-containing protein 3) (PKC-delta-interacting protein kinase)	EBI-12503575	0.35
Q13563	Polycystin-2 (PC2) (Autosomal dominant polycystic kidney disease type II protein) (Polycystic kidney disease 2 protein) (Polycystwin) (R48321) (Transient receptor potential cation channel subfamily P member 2)	EBI-9837080	0.37
P30411	B2 bradykinin receptor (B2R) (BK-2 receptor)	EBI-9843662	0.37
P01583	Interleukin-1 alpha (IL-1 alpha) (Hematopoietin-1)	EBI-10488769	0.62
Q13418	Integrin-linked protein kinase (EC 2.7.11.1) (59 kDa serine/threonine-protein kinase) (Beta-integrin-linked kinase) (ILK-1) (ILK-2) (p59ILK)	EBI-10103376	0.53
P06460	Probable protein E5A	EBI-11723082	0.35
P69901	Probable protein E5B	EBI-11733364	0.35
P36895	Bone morphogenetic protein receptor type-1A (BMP type-1A receptor) (BMPR-1A) (EC 2.7.11.30) (Activin receptor-like kinase 3) (ALK-3) (BMP-2/BMP-4 receptor) (Serine/threonine-protein kinase receptor R5) (SKR5) (CD antigen CD292)	EBI-11008521	0.35
Q9NVH1	DnaJ homolog subfamily C member 11	EBI-11107761	0.35
O00400	Acetyl-coenzyme A transporter 1 (AT-1) (Acetyl-CoA transporter 1) (Solute carrier family 33 member 1)	EBI-11135399	0.35
Q9BQE3	Tubulin alpha-1C chain (EC 3.6.5.-) (Alpha-tubulin 6) (Tubulin alpha-6 chain) [Cleaved into: Detyrosinated tubulin alpha-1C chain]	EBI-11139064	0.35
O94905	Erlin-2 (Endoplasmic reticulum lipid raft-associated protein 2) (Stomatin-prohibitin-flotillin-HflC/K domain-containing protein 2) (SPFH domain-containing protein 2)	EBI-11425731	0.35
Q6P5F9	Exportin-1 (Exp1) (Chromosome region maintenance 1 protein homolog)	EBI-11603310	0.35
Q9BW83	Intraflagellar transport protein 27 homolog (Putative GTP-binding protein RAY-like) (Rab-like protein 4)	EBI-12453281	0.35
Q71U36	Tubulin alpha-1A chain (EC 3.6.5.-) (Alpha-tubulin 3) (Tubulin B-alpha-1) (Tubulin alpha-3 chain) [Cleaved into: Detyrosinated tubulin alpha-1A chain]	EBI-11897791	0.53
Q68871	Genome polyprotein	EBI-12518818	0.51
P03452	Hemagglutinin [Cleaved into: Hemagglutinin HA1 chain; Hemagglutinin HA2 chain]	EBI-12577240	0.35
P06821	Matrix protein 2 (Proton channel protein M2)	EBI-12577493	0.35
P03431	RNA-directed RNA polymerase catalytic subunit (EC 2.7.7.48) (Polymerase basic protein 1) (PB1) (RNA-directed RNA polymerase subunit P1)	EBI-12579142	0.35
P03428	Polymerase basic protein 2 (RNA-directed RNA polymerase subunit P3)	EBI-12579909	0.35
I6T1Z2	Non-structural protein 1 (NS1)	EBI-12581764	0.35
Q5EP37	RNA-directed RNA polymerase catalytic subunit (EC 2.7.7.48) (Polymerase basic protein 1) (PB1) (RNA-directed RNA polymerase subunit P1)	EBI-12582596	0.35
Q1K9H5	RNA-directed RNA polymerase catalytic subunit (EC 2.7.7.48) (Polymerase basic protein 1) (PB1) (RNA-directed RNA polymerase subunit P1)	EBI-12588098	0.35
B4URF7	Polymerase basic protein 2 (RNA-directed RNA polymerase subunit P3)	EBI-12588729	0.35
Q7RTP6	[F-actin]-monooxygenase MICAL3 (EC 1.14.13.225) (Molecule interacting with CasL protein 3) (MICAL-3)	EBI-13945615	0.35
O14829	Serine/threonine-protein phosphatase with EF-hands 1 (PPEF-1) (EC 3.1.3.16) (Protein phosphatase with EF calcium-binding domain) (PPEF) (Serine/threonine-protein phosphatase 7) (PP7)	EBI-14024386	0.35
Q9BY84	Dual specificity protein phosphatase 16 (EC 3.1.3.16) (EC 3.1.3.48) (Mitogen-activated protein kinase phosphatase 7) (MAP kinase phosphatase 7) (MKP-7)	EBI-14027455	0.35
P13591	Neural cell adhesion molecule 1 (N-CAM-1) (NCAM-1) (CD antigen CD56)	EBI-21602719	0.35
P10636	Microtubule-associated protein tau (Neurofibrillary tangle protein) (Paired helical filament-tau) (PHF-tau)	EBI-21602719	0.35
Q9UQM7	Calcium/calmodulin-dependent protein kinase type II subunit alpha (CaM kinase II subunit alpha) (CaMK-II subunit alpha) (EC 2.7.11.17)	EBI-21602719	0.35
Q9UPY8	Microtubule-associated protein RP/EB family member 3 (EB1 protein family member 3) (EBF3) (End-binding protein 3) (EB3) (RP3)	EBI-21602719	0.35
Q9ULP0	Protein NDRG4 (Brain development-related molecule 1) (N-myc downstream-regulated gene 4 protein) (Vascular smooth muscle cell-associated protein 8) (SMAP-8)	EBI-21602719	0.35
Q9P121	Neurotrimin (hNT) (IgLON family member 2)	EBI-21602719	0.35
Q9NRW1	Ras-related protein Rab-6B (EC 3.6.5.2)	EBI-21602719	0.35
Q9H4G0	Band 4.1-like protein 1 (Erythrocyte membrane protein band 4.1-like 1) (Neuronal protein 4.1) (4.1N)	EBI-21602719	0.35
Q9H115	Beta-soluble NSF attachment protein (SNAP-beta) (N-ethylmaleimide-sensitive factor attachment protein beta)	EBI-21602719	0.35
Q9BPU6	Dihydropyrimidinase-related protein 5 (DRP-5) (CRMP3-associated molecule) (CRAM) (Collapsin response mediator protein 5) (CRMP-5) (UNC33-like phosphoprotein 6) (ULIP-6)	EBI-21602719	0.35
Q99880	Histone H2B type 1-L (Histone H2B.c) (H2B/c)	EBI-21602719	0.35
Q92777	Synapsin-2 (Synapsin II)	EBI-21602719	0.35
Q8NCB2	CaM kinase-like vesicle-associated protein	EBI-21602719	0.35
Q8IZL9	Cyclin-dependent kinase 20 (EC 2.7.11.22) (CDK-activating kinase p42) (CAK-kinase p42) (Cell cycle-related kinase) (Cell division protein kinase 20) (Cyclin-dependent protein kinase H) (Cyclin-kinase-activating kinase p42)	EBI-21602719	0.35
Q16623	Syntaxin-1A (Neuron-specific antigen HPC-1)	EBI-21602719	0.35
Q16555	Dihydropyrimidinase-related protein 2 (DRP-2) (Collapsin response mediator protein 2) (CRMP-2) (N2A3) (Unc-33-like phosphoprotein 2) (ULIP-2)	EBI-21602719	0.35
Q14847	LIM and SH3 domain protein 1 (LASP-1) (Metastatic lymph node gene 50 protein) (MLN 50)	EBI-21602719	0.35
Q14194	Dihydropyrimidinase-related protein 1 (DRP-1) (Collapsin response mediator protein 1) (CRMP-1) (Inactive dihydropyrimidinase) (Unc-33-like phosphoprotein 3) (ULIP-3)	EBI-21602719	0.35
Q13554	Calcium/calmodulin-dependent protein kinase type II subunit beta (CaM kinase II subunit beta) (CaMK-II subunit beta) (EC 2.7.11.17)	EBI-21602719	0.35
Q12860	Contactin-1 (Glycoprotein gp135) (Neural cell surface protein F3)	EBI-21602719	0.35
Q05193	Dynamin-1 (EC 3.6.5.5)	EBI-21602719	0.35
Q01484	Ankyrin-2 (ANK-2) (Ankyrin-B) (Brain ankyrin) (Non-erythroid ankyrin)	EBI-21602719	0.35
P84074	Neuron-specific calcium-binding protein hippocalcin (Calcium-binding protein BDR-2)	EBI-21602719	0.35
P62760	Visinin-like protein 1 (VILIP) (VLP-1) (Hippocalcin-like protein 3) (HLP3)	EBI-21602719	0.35
P61764	Syntaxin-binding protein 1 (MUNC18-1) (N-Sec1) (Protein unc-18 homolog 1) (Unc18-1) (Protein unc-18 homolog A) (Unc-18A) (p67)	EBI-21602719	0.35
P61601	Neurocalcin-delta	EBI-21602719	0.35
P61266	Syntaxin-1B (Syntaxin-1B1) (Syntaxin-1B2)	EBI-21602719	0.35
P59768	Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2 (G gamma-I)	EBI-21602719	0.35
P43304	Glycerol-3-phosphate dehydrogenase, mitochondrial (GPD-M) (GPDH-M) (EC 1.1.5.3) (mitohondrial glycerophosphate dehydrogenase gene) (mGDH) (mtGPD)	EBI-21602719	0.35
P42658	Dipeptidyl aminopeptidase-like protein 6 (DPPX) (Dipeptidyl aminopeptidase-related protein) (Dipeptidyl peptidase 6) (Dipeptidyl peptidase IV-like protein) (Dipeptidyl peptidase VI) (DPP VI)	EBI-21602719	0.35
P42262	Glutamate receptor 2 (GluR-2) (AMPA-selective glutamate receptor 2) (GluR-B) (GluR-K2) (Glutamate receptor ionotropic, AMPA 2) (GluA2)	EBI-21602719	0.35
P37235	Hippocalcin-like protein 1 (Calcium-binding protein BDR-1) (HLP2) (Visinin-like protein 3) (VILIP-3)	EBI-21602719	0.35
P32004	Neural cell adhesion molecule L1 (N-CAM-L1) (NCAM-L1) (CD antigen CD171)	EBI-21602719	0.35
P31323	cAMP-dependent protein kinase type II-beta regulatory subunit	EBI-21602719	0.35
P22676	Calretinin (CR) (29 kDa calbindin)	EBI-21602719	0.35
P21579	Synaptotagmin-1 (Synaptotagmin I) (SytI) (p65)	EBI-21602719	0.35
P20648	Potassium-transporting ATPase alpha chain 1 (EC 7.2.2.19) (Gastric H(+)/K(+) ATPase subunit alpha) (Proton pump)	EBI-21602719	0.35
P20336	Ras-related protein Rab-3A	EBI-21602719	0.35
P17600	Synapsin-1 (Brain protein 4.1) (Synapsin I)	EBI-21602719	0.35
P16401	Histone H1.5 (Histone H1a) (Histone H1b) (Histone H1s-3)	EBI-21602719	0.35
P11137	Microtubule-associated protein 2 (MAP-2)	EBI-21602719	0.35
P09471	Guanine nucleotide-binding protein G(o) subunit alpha	EBI-21602719	0.35
P05090	Apolipoprotein D (Apo-D) (ApoD)	EBI-21602719	0.35
O60641	Clathrin coat assembly protein AP180 (91 kDa synaptosomal-associated protein) (Clathrin coat-associated protein AP180) (Phosphoprotein F1-20)	EBI-21602719	0.35
O43854	EGF-like repeat and discoidin I-like domain-containing protein 3 (Developmentally-regulated endothelial cell locus 1 protein) (Integrin-binding protein DEL1)	EBI-21602719	0.35
O43602	Neuronal migration protein doublecortin (Doublin) (Lissencephalin-X) (Lis-X)	EBI-21602719	0.35
O15075	Serine/threonine-protein kinase DCLK1 (EC 2.7.11.1) (Doublecortin domain-containing protein 3A) (Doublecortin-like and CAM kinase-like 1) (Doublecortin-like kinase 1)	EBI-21602719	0.35
O00429	Dynamin-1-like protein (EC 3.6.5.5) (Dnm1p/Vps1p-like protein) (DVLP) (Dynamin family member proline-rich carboxyl-terminal domain less) (Dymple) (Dynamin-like protein) (Dynamin-like protein 4) (Dynamin-like protein IV) (HdynIV) (Dynamin-related protein 1)	EBI-21602719	0.35
B7Z613	Neuronal membrane glycoprotein M6-b (cDNA FLJ54144, highly similar to Neuronal membrane glycoprotein M6-b)	EBI-21602719	0.35
Q14195	Dihydropyrimidinase-related protein 3 (DRP-3) (Collapsin response mediator protein 4) (CRMP-4) (Unc-33-like phosphoprotein 1) (ULIP-1)	EBI-21602719	0.35
P51674	Neuronal membrane glycoprotein M6-a (M6a)	EBI-21648883	0.35
O15126	Secretory carrier-associated membrane protein 1 (Secretory carrier membrane protein 1)	EBI-21648858	0.35
Q9H4B6	Protein salvador homolog 1 (45 kDa WW domain protein) (hWW45)	EBI-16427846	0.74
Q96RS6	NudC domain-containing protein 1 (Chronic myelogenous leukemia tumor antigen 66) (Tumor antigen CML66)	EBI-20723859	0.35
Q6ZNJ1	Neurobeachin-like protein 2	EBI-16749633	0.35
Q96I36	Cytochrome c oxidase assembly protein COX14	EBI-16791250	0.27
P13073	Cytochrome c oxidase subunit 4 isoform 1, mitochondrial (Cytochrome c oxidase polypeptide IV) (Cytochrome c oxidase subunit IV isoform 1) (COX IV-1)	EBI-16791533	0.27
Q9HBL7	Plasminogen receptor (KT) (Plg-R(KT))	EBI-16797429	0.27
O75880	Protein SCO1 homolog, mitochondrial	EBI-16799233	0.27
Q9H9B4	Sideroflexin-1	EBI-16799442	0.27
P11279	Lysosome-associated membrane glycoprotein 1 (LAMP-1) (Lysosome-associated membrane protein 1) (CD107 antigen-like family member A) (CD antigen CD107a)	EBI-16795231	0.35
P08559	Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial (EC 1.2.4.1) (PDHE1-A type I)	EBI-20306509	0.35
P46013	Proliferation marker protein Ki-67 (Antigen identified by monoclonal antibody Ki-67) (Antigen KI-67) (Antigen Ki67)	EBI-20562326	0.35
Q9BRX2	Protein pelota homolog (EC 3.1.-.-)	EBI-20567704	0.66
Q92844	TRAF family member-associated NF-kappa-B activator (TRAF-interacting protein) (I-TRAF)	EBI-20737201	0.35
A2A935	Histone-lysine N-methyltransferase PRDM16 (EC 2.1.1.367) (PR domain zinc finger protein 16) (PR domain-containing protein 16) (Transcription factor MEL1) (MDS1/EVI1-like gene 1)	EBI-21022882	0.35
P14404	Histone-lysine N-methyltransferase MECOM (EC 2.1.1.367) (Ecotropic virus integration site 1 protein) (EVI-1) (MDS1 and EVI1 complex locus protein) (Myelodysplasia syndrome 1 protein homolog)	EBI-21026252	0.35
Q15077	P2Y purinoceptor 6 (P2Y6)	EBI-21262943	0.35
F5H1C8	Solute carrier family 15 member 3 (Solute carrier family 15, member 3, isoform CRA_a)	EBI-21264930	0.35
X6RFA8	Mitoferrin-2	EBI-21265624	0.35
Q9H1C4	Protein unc-93 homolog B1 (Unc-93B1) (hUNC93B1)	EBI-21266770	0.35
P03427	Polymerase basic protein 2 (RNA-directed RNA polymerase subunit P3)	EBI-21268420	0.35
Q6ZRI8	Rho GTPase-activating protein 36	EBI-25410669	0.35
P0DOF2	Matrix protein (Phosphoprotein M2)	EBI-25603126	0.35
O95072	Meiotic recombination protein REC8 homolog (Cohesin Rec8p)	EBI-25483697	0.35
P59046	NACHT, LRR and PYD domains-containing protein 12 (Monarch-1) (PYRIN-containing APAF1-like protein 7) (Regulated by nitric oxide)	EBI-25499386	0.37
P0DTC5	Membrane protein (M) (E1 glycoprotein) (Matrix glycoprotein) (Membrane glycoprotein)	EBI-25685699	0.35
Q8N4Q1	Mitochondrial intermembrane space import and assembly protein 40 (Coiled-coil-helix-coiled-coil-helix domain-containing protein 4)	EBI-25744959	0.35
O43572	A-kinase anchor protein 10, mitochondrial (AKAP-10) (Dual specificity A kinase-anchoring protein 2) (D-AKAP-2) (Protein kinase A-anchoring protein 10) (PRKA10)	EBI-26451580	0.35
P61981	14-3-3 protein gamma (Protein kinase C inhibitor protein 1) (KCIP-1) [Cleaved into: 14-3-3 protein gamma, N-terminally processed]	EBI-25902182	0.56
Q15047	Histone-lysine N-methyltransferase SETDB1 (EC 2.1.1.366) (ERG-associated protein with SET domain) (ESET) (Histone H3-K9 methyltransferase 4) (H3-K9-HMTase 4) (Lysine N-methyltransferase 1E) (SET domain bifurcated 1)	EBI-25909133	0.56
Q8TAP4	LIM domain only protein 3 (LMO-3) (Neuronal-specific transcription factor DAT1) (Rhombotin-3)	EBI-25926058	0.56
O43464	Serine protease HTRA2, mitochondrial (EC 3.4.21.108) (High temperature requirement protein A2) (HtrA2) (Omi stress-regulated endoprotease) (Serine protease 25) (Serine proteinase OMI)	EBI-27049380	0.42
Q96LU5	Mitochondrial inner membrane protease subunit 1 (EC 3.4.21.-) (IMP1-like protein)	EBI-27049466	0.27
P83111	Serine beta-lactamase-like protein LACTB, mitochondrial (EC 3.4.-.-)	EBI-27049642	0.27
Q96E52	Metalloendopeptidase OMA1, mitochondrial (EC 3.4.24.-) (Metalloprotease-related protein 1) (MPRP-1) (Overlapping with the m-AAA protease 1 homolog)	EBI-27049801	0.27
Q9H300	Presenilins-associated rhomboid-like protein, mitochondrial (EC 3.4.21.105) (Mitochondrial intramembrane cleaving protease PARL) [Cleaved into: P-beta (Pbeta)]	EBI-27049982	0.27
Q96TA2	ATP-dependent zinc metalloprotease YME1L1 (EC 3.4.24.-) (ATP-dependent metalloprotease FtsH1) (Meg-4) (Presenilin-associated metalloprotease) (PAMP) (YME1-like protein 1)	EBI-27050177	0.27
O14733	Dual specificity mitogen-activated protein kinase kinase 7 (MAP kinase kinase 7) (MAPKK 7) (EC 2.7.12.2) (JNK-activating kinase 2) (MAPK/ERK kinase 7) (MEK 7) (Stress-activated protein kinase kinase 4) (SAPK kinase 4) (SAPKK-4) (SAPKK4) (c-Jun N-terminal kinase kinase 2) (JNK kinase 2) (JNKK 2)	EBI-28930089	0.35
O14757	Serine/threonine-protein kinase Chk1 (EC 2.7.11.1) (CHK1 checkpoint homolog) (Cell cycle checkpoint kinase) (Checkpoint kinase-1)	EBI-28930743	0.35
P04049	RAF proto-oncogene serine/threonine-protein kinase (EC 2.7.11.1) (Proto-oncogene c-RAF) (cRaf) (Raf-1)	EBI-28931531	0.35
P22612	cAMP-dependent protein kinase catalytic subunit gamma (PKA C-gamma) (EC 2.7.11.11)	EBI-28934688	0.35
P43250	G protein-coupled receptor kinase 6 (EC 2.7.11.16) (G protein-coupled receptor kinase GRK6)	EBI-28935197	0.35
P51617	Interleukin-1 receptor-associated kinase 1 (IRAK-1) (EC 2.7.11.1)	EBI-28935882	0.35
Q7Z695	Uncharacterized aarF domain-containing protein kinase 2 (EC 2.7.11.-)	EBI-28941998	0.35
Q92918	Mitogen-activated protein kinase kinase kinase kinase 1 (EC 2.7.11.1) (Hematopoietic progenitor kinase) (MAPK/ERK kinase kinase kinase 1) (MEK kinase kinase 1) (MEKKK 1)	EBI-28944233	0.35
Q9BXA6	Testis-specific serine/threonine-protein kinase 6 (TSK-6) (TSSK-6) (Testis-specific kinase 6) (EC 2.7.11.1) (Cancer/testis antigen 72) (CT72) (Serine/threonine-protein kinase SSTK) (Small serine/threonine kinase)	EBI-28945972	0.35
Q9H3Y6	Tyrosine-protein kinase Srms (EC 2.7.10.2)	EBI-28946258	0.35
Q9NR20	Dual specificity tyrosine-phosphorylation-regulated kinase 4 (EC 2.7.12.1)	EBI-28946409	0.35
Q9NRM7	Serine/threonine-protein kinase LATS2 (EC 2.7.11.1) (Kinase phosphorylated during mitosis protein) (Large tumor suppressor homolog 2) (Serine/threonine-protein kinase kpm) (Warts-like kinase)	EBI-28946455	0.35
Q9NSY0	Nuclear receptor-binding protein 2 (Transformation-related gene 16 protein) (TRG-16)	EBI-28946547	0.35
O14595	Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 2 (EC 3.1.3.16) (Nuclear LIM interactor-interacting factor 2) (NLI-interacting factor 2) (Protein OS-4) (Small C-terminal domain phosphatase 2) (Small CTD phosphatase 2) (SCP2)	EBI-27113200	0.35
O14830	Serine/threonine-protein phosphatase with EF-hands 2 (PPEF-2) (EC 3.1.3.16)	EBI-27113806	0.35
P35916	Vascular endothelial growth factor receptor 3 (VEGFR-3) (EC 2.7.10.1) (Fms-like tyrosine kinase 4) (FLT-4) (Tyrosine-protein kinase receptor FLT4)	EBI-32718614	0.42
P08069	Insulin-like growth factor 1 receptor (EC 2.7.10.1) (Insulin-like growth factor I receptor) (IGF-I receptor) (CD antigen CD221) [Cleaved into: Insulin-like growth factor 1 receptor alpha chain; Insulin-like growth factor 1 receptor beta chain]	EBI-32718669	0.35
P06213	Insulin receptor (IR) (EC 2.7.10.1) (CD antigen CD220) [Cleaved into: Insulin receptor subunit alpha; Insulin receptor subunit beta]	EBI-32718777	0.35
P04629	High affinity nerve growth factor receptor (EC 2.7.10.1) (Neurotrophic tyrosine kinase receptor type 1) (TRK1-transforming tyrosine kinase protein) (Tropomyosin-related kinase A) (Tyrosine kinase receptor) (Tyrosine kinase receptor A) (Trk-A) (gp140trk) (p140-TrkA)	EBI-32719115	0.35
Q16288	NT-3 growth factor receptor (EC 2.7.10.1) (GP145-TrkC) (Trk-C) (Neurotrophic tyrosine kinase receptor type 3) (TrkC tyrosine kinase)	EBI-32719212	0.35
Q06418	Tyrosine-protein kinase receptor TYRO3 (EC 2.7.10.1) (Tyrosine-protein kinase BYK) (Tyrosine-protein kinase DTK) (Tyrosine-protein kinase RSE) (Tyrosine-protein kinase SKY) (Tyrosine-protein kinase TIF)	EBI-32719716	0.35

Cross-References

Database	Links
UNIPROT	O00165 A8W4W9 A8W4X0 B4DUJ7 Q5VYD5 Q5VYD7 Q96AU4 Q9BS80
OMIM	605998 610738
DisGeNET	10456

HCLS1-associated protein X-1 (Homo sapiens)

General Information

Protein Information

Subcellular Location

Description Show

Position in the Nuclear Envelope

Membrane Topology

Assigned Ontology terms

Biology & Function

Description Hide

Assigned Ontology terms

Disease associations

Description

Database Associations

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (8 interactors)

Interactions with other proteins (216 interactors)

Cross-References

Database

Links

Description

Description