Ras-related protein Rab-7L1 - Homo sapiens

Ras-related protein Rab-7L1 (Homo sapiens)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	Ras-related protein Rab-7L1
Accession Code	O14966
Gene	RAB29
Organism	Homo sapiens \| Human (Taxonomy: 9606)
Part of Reference Proteome?	Yes
Sequence (Length: 203)
MGSRDHLFKVLVVGDAAVGKTSLVQRYSQDSFSKHYKSTVGVDFALKVLQWSDYEIVRLQLWDIAGQERFTSMTRLYYRD ASACVIMFDVTNATTFSNSQRWKQDLDSKLTLPNGEPVPCLLLANKCDLSPWAVSRDQIDRFSKENGFTGWTETSVKENK NINEAMRVLIEKMMRNSTEDIMSLSTQGDYINLQTKSSSWSCC

Structure Viewer (PDB: 6HH2)

Subcellular Location

Description
Cell membrane {Curator Inference}; Lipid-anchor {Curator Inference}; Cytoplasmic side {Curator Inference}. Cytoplasm {Experimental EvidencePubMed:24788816, ECO:0000269\|PubMed:29212815}. Cytoplasm, perinuclear region {Experimental EvidencePubMed:24788816}. Golgi apparatus {ECO:0000269\|PubMed:22042847}. Golgi apparatus, trans-Golgi network {Experimental EvidencePubMed:24788816, ECO:0000269\|PubMed:29212815}. Vacuole {ECO:0000269\|PubMed:22042847}. Cytoplasm, cytoskeleton {ECO:0000269\|PubMed:22042847}. Note=Colocalizes with LRRK2 along tubular structures emerging from Golgi apparatus (PubMed:29212815). Colocalizes with GM130 at the Golgi apparatus (PubMed:22042847). Colocalizes with dynamic tubules emerging from and retracting to the Golgi apparatus (PubMed:22042847). Colocalizes with TGN46 at the trans- Golgi network (TGN) (PubMed:24788816). In Salmonella enterica serovar Typhi (S.Typhi) infected epithelial cells, is recruited and colocalized with both S.Typhi-containing vacuoles and dynamic tubules as well as those emerging from the vacuole toward the cell periphery (PubMed:22042847). {ECO:0000269\|PubMed:22042847, Experimental EvidencePubMed:24788816, ECO:0000269\|PubMed:29212815}.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Lipid-Anchored	UniProt	By Similarity {ECO:0000250}
Assigned Ontology terms

Cellular Component	Cis-Golgi Network (GO:0005801) Cytoplasm (GO:0005737) Cytoskeleton (GO:0005856) Cytosol (GO:0005829) Early Endosome (GO:0005769) Extracellular Exosome (GO:0070062) Golgi Apparatus (GO:0005794) Intracellular Membrane-Bounded Organelle (GO:0043231) Intracellular Vesicle (GO:0097708) Melanosome (GO:0042470) Mitochondrion (GO:0005739) Perinuclear Region Of Cytoplasm (GO:0048471) Plasma Membrane (GO:0005886) Recycling Endosome (GO:0055037) Trans-Golgi Network (GO:0005802) Vacuole (GO:0005773)

Biology & Function

Description
The small GTPases Rab are key regulators in vesicle trafficking (PubMed:24788816). Essential for maintaining the integrity of the endosome-trans-Golgi network structure (By similarity). Together with LRRK2, plays a role in the retrograde trafficking pathway for recycling proteins, such as mannose 6 phosphate receptor (M6PR), between lysosomes and the Golgi apparatus in a retromer-dependent manner (PubMed:24788816). Recruits LRRK2 to the Golgi complex and stimulates LRRK2 kinase activity (PubMed:29212815). Regulates neuronal process morphology in the intact central nervous system (CNS) (By similarity). May play a role in the formation of typhoid toxin transport intermediates during Salmonella enterica serovar Typhi (S.Typhi) epithelial cell infection (PubMed:22042847). {By SimilarityUniProtKB:Q63481, Experimental EvidencePubMed:22042847, Experimental EvidencePubMed:24788816, Experimental EvidencePubMed:29212815}.
Assigned Ontology terms

Biological Process	Cell Differentiation (GO:0030154) Golgi Organization (GO:0007030) Intracellular Protein Transport (GO:0006886) Melanosome Organization (GO:0032438) Mitochondrion Organization (GO:0007005) Modulation By Host Of Viral Process (GO:0044788) Negative Regulation Of Neuron Projection Development (GO:0010977) Positive Regulation Of Intracellular Protein Transport (GO:0090316) Positive Regulation Of Receptor Recycling (GO:0001921) Positive Regulation Of T Cell Receptor Signaling Pathway (GO:0050862) Protein Localization To Ciliary Membrane (GO:1903441) Protein Localization To Membrane (GO:0072657) Regulation Of Neuron Death (GO:1901214) Regulation Of Retrograde Transport, Endosome To Golgi (GO:1905279) Response To Bacterium (GO:0009617) Retrograde Transport, Endosome To Golgi (GO:0042147) Synapse Assembly (GO:0007416) T Cell Activation (GO:0042110) Toxin Transport (GO:1901998)
Molecular Function	Dynein Complex Binding (GO:0070840) GDP Binding (GO:0019003) GTP Binding (GO:0005525) GTPase Activity (GO:0003924) Kinesin Binding (GO:0019894) Small GTPase Binding (GO:0031267)

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (2 interactors)

Partner (NucEnvDB)		IntAct	Confidence score
O14976	Cyclin-G-associated kinase	EBI-9247728	0.35
Q14643	Inositol 1,4,5-trisphosphate receptor type 1	EBI-21858632	0.35
Interactions with other proteins (22 interactors)

Partner (UniProt)		IntAct	Confidence score
Q9UK45	U6 snRNA-associated Sm-like protein LSm7	EBI-373977	0.00
A0A380PDF6	Putative amino-acid ABC transporter (Permease)	EBI-2856699	0.00
Q5S007	Leucine-rich repeat serine/threonine-protein kinase 2 (EC 2.7.11.1) (EC 3.6.5.-) (Dardarin)	EBI-9247238	0.76
P11142	Heat shock cognate 71 kDa protein (EC 3.6.4.10) (Heat shock 70 kDa protein 8) (Lipopolysaccharide-associated protein 1) (LAP-1) (LPS-associated protein 1)	EBI-9247728	0.35
P14373	Zinc finger protein RFP (EC 2.3.2.27) (RING finger protein 76) (RING-type E3 ubiquitin transferase TRIM27) (Ret finger protein) (Tripartite motif-containing protein 27)	EBI-24492416	0.56
Q04864	Proto-oncogene c-Rel	EBI-24371046	0.56
O95751	Protein LDOC1 (Leucine zipper protein down-regulated in cancer cells)	EBI-24414905	0.67
Q13049	E3 ubiquitin-protein ligase TRIM32 (EC 2.3.2.27) (72 kDa Tat-interacting protein) (RING-type E3 ubiquitin transferase TRIM32) (Tripartite motif-containing protein 32) (Zinc finger protein HT2A)	EBI-24451423	0.56
Q9NVJ2	ADP-ribosylation factor-like protein 8B (EC 3.6.5.2) (ADP-ribosylation factor-like protein 10C) (Novel small G protein indispensable for equal chromosome segregation 1)	EBI-21858632	0.35
Q96LI5	CCR4-NOT transcription complex subunit 6-like (EC 3.1.13.4) (Carbon catabolite repressor protein 4 homolog B)	EBI-21858632	0.35
Q92696	Geranylgeranyl transferase type-2 subunit alpha (EC 2.5.1.60) (Geranylgeranyl transferase type II subunit alpha) (Rab geranyl-geranyltransferase subunit alpha) (Rab GG transferase alpha) (Rab GGTase alpha) (Rab geranylgeranyltransferase subunit alpha)	EBI-21858632	0.35
Q5VSL9	Striatin-interacting protein 1 (Protein FAM40A)	EBI-21858632	0.35
Q14573	Inositol 1,4,5-trisphosphate receptor type 3 (IP3 receptor isoform 3) (IP3R 3) (InsP3R3) (Type 3 inositol 1,4,5-trisphosphate receptor) (Type 3 InsP3 receptor)	EBI-21858632	0.35
Q14571	Inositol 1,4,5-trisphosphate receptor type 2 (IP3 receptor isoform 2) (IP3R 2) (InsP3R2) (Type 2 inositol 1,4,5-trisphosphate receptor) (Type 2 InsP3 receptor)	EBI-21858632	0.35
Q04656	Copper-transporting ATPase 1 (EC 7.2.2.8) (Copper pump 1) (Menkes disease-associated protein)	EBI-21858632	0.35
P26374	Rab proteins geranylgeranyltransferase component A 2 (Choroideremia-like protein) (Rab escort protein 2) (REP-2)	EBI-21858632	0.35
P24386	Rab proteins geranylgeranyltransferase component A 1 (Choroideremia protein) (Rab escort protein 1) (REP-1) (TCD protein)	EBI-21858632	0.35
H9L447	Gifsy-2 prophage protein	EBI-15950513	0.44
Q9H6J7	Centriolar satellite-associated tubulin polyglutamylase complex regulator 1	EBI-22145198	0.37
Q9ULR3	Protein phosphatase 1H (EC 3.1.3.16)	EBI-22223478	0.35
P57729	Ras-related protein Rab-38 (Melanoma antigen NY-MEL-1)	EBI-22225674	0.40
Q8TEV9	Guanine nucleotide exchange protein SMCR8 (Smith-Magenis syndrome chromosomal region candidate gene 8 protein)	EBI-26618985	0.40

Cross-References

Database	Links
UNIPROT	O14966 B4E1K3 C9JE77
PDB	6HH2
Pfam	PF00071
PROSITE	PS51419
OMIM	603949
DisGeNET	8934

Ras-related protein Rab-7L1 (Homo sapiens)

General Information

Protein Information

Structure Viewer (PDB: 6HH2)

Subcellular Location

Description Show

Position in the Nuclear Envelope

Membrane Topology

Assigned Ontology terms

Biology & Function

Description Hide

Assigned Ontology terms

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (2 interactors)

Interactions with other proteins (22 interactors)

Cross-References

Database

Links

Description

Description