Protein Information |
|
|---|---|
| Protein Name | Cyclin-G-associated kinase |
| Accession Code | O14976 |
| Gene | GAK |
| Organism | Homo sapiens | Human (Taxonomy: 9606) |
| Part of Reference Proteome? | Yes |
| Sequence (Length: 1311) | |
|
MSLLQSALDFLAGPGSLGGASGRDQSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDVGSGREYALKRLLSNEEEKNR AIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQAEFLLLTELCKGQLVEFLKKMESRGPLSCDTVLKIFYQTCRAVQ HMHRQKPPIIHRDLKVENLLLSNQGTIKLCDFGSATTISHYPDYSWSAQRRALVEEEITRNTTPMYRTPEIIDLYSNFPI GEKQDIWALGCILYLLCFRQHPFEDGAKLRIVNGKYSIPPHDTQYTVFHSLIRAMLQVNPEERLSIAEVVHQLQEIAAAR NVNPKSPITELLEQNGGYGSATLSRGPPPPVGPAGSGYSGGLALAEYDQPYGGFLDILRGGTERLFTNLKDTSSKVIQSV ANYAKGDLDISYITSRIAVMSFPAEGVESALKNNIEDVRLFLDSKHPGHYAVYNLSPRTYRPSRFHNRVSECGWAARRAP HLHTLYNICRNMHAWLRQDHKNVCVVHCMDGRAASAVAVCSFLCFCRLFSTAEAAVYMFSMKRCPPGIWPSHKRYIEYMC DMVAEEPITPHSKPILVRAVVMTPVPLFSKQRSGCRPFCEVYVGDERVASTSQEYDKMRDFKIEDGKAVIPLGVTVQGDV LIVIYHARSTLGGRLQAKMASMKMFQIQFHTGFVPRNATTVKFAKYDLDACDIQEKYPDLFQVNLEVEVEPRDRPSREAP PWENSSMRGLNPKILFSSREEQQDILSKFGKPELPRQPGSTAQYDAGAGSPEAEPTDSDSPPSSSADASRFLHTLDWQEE KEAETGAENASSKESESALMEDRDESEVSDEGGSPISSEGQEPRADPEPPGLAAGLVQQDLVFEVETPAVLPEPVPQEDG VDLLGLHSEVGAGPAVPPQACKAPSSNTDLLSCLLGPPEAASQGPPEDLLSEDPLLLASPAPPLSVQSTPRGGPPAAADP FGPLLPSSGNNSQPCSNPDLFGEFLNSDSVTVPPSFPSAHSAPPPSCSADFLHLGDLPGEPSKMTASSSNPDLLGGWAAW TETAASAVAPTPATEGPLFSPGGQPAPCGSQASWTKSQNPDPFADLGDLSSGLQGSPAGFPPGGFIPKTATTPKGSSSWQ TSRPPAQGASWPPQAKPPPKACTQPRPNYASNFSVIGAREERGVRAPSFAQKPKVSENDFEDLLSNQGFSSRSDKKGPKT IAEMRKQDLAKDTDPLKLKLLDWIEGKERNIRALLSTLHTVLWDGESRWTPVGMADLVAPEQVKKHYRRAVLAVHPDKAA GQPYEQHAKMIFMELNDAWSEFENQGSRPLF |
|
Structure Viewer (PDB: 4C58) |
|---|
Description |
||
|---|---|---|
| Cytoplasm, perinuclear region {Experimental EvidencePubMed:10625686}. Golgi apparatus, trans-Golgi network {Experimental EvidencePubMed:10625686}. Cell junction, focal adhesion {ECO:0000305|PubMed:10625686}. Note=Localizes to the perinuclear area and to the trans-Golgi network. Also seen on the plasma membrane, probably at focal adhesions. | Position in the Nuclear Envelope |
|
| Location | Location ID | Description |
| Perinuclear Region | SL-0198 | The perinuclear region is the cytoplasmic region just around the nucleus. | Membrane Topology |
| Topology | Source | Annotation Type |
| Unknown | UniProt | Sequence Analysis | Assigned Ontology terms |
| Cellular Component | Cytoplasm (GO:0005737) Cytosol (GO:0005829) Focal Adhesion (GO:0005925) Golgi Apparatus (GO:0005794) Intracellular Membrane-Bounded Organelle (GO:0043231) Membrane (GO:0016020) Perinuclear Region Of Cytoplasm (GO:0048471) Presynapse (GO:0098793) Vesicle (GO:0031982) |
|
Interactions with Nuclear Envelope proteins (9 interactors) |
|||
|---|---|---|---|
| Partner (NucEnvDB) | IntAct | Confidence score | |
| O14966 | Ras-related protein Rab-7L1 | EBI-9247728 | 0.35 |
| P63005 | Platelet-activating factor acetylhydrolase IB subunit beta | EBI-11041417 | 0.35 |
| O15027 | Protein transport protein Sec16A | EBI-11083608 | 0.35 |
| O75146 | Huntingtin-interacting protein 1-related protein | EBI-11150908 | 0.53 |
| P55735 | Protein SEC13 homolog | EBI-11150908 | 0.35 |
| Q27J81 | Inverted formin-2 | EBI-11150908 | 0.35 |
| Q9UM54 | Unconventional myosin-VI | EBI-11150908 | 0.35 |
| Q07912 | Activated CDC42 kinase 1 | EBI-11150908 | 0.35 |
| Q14677 | Clathrin interactor 1 | EBI-11150908 | 0.35 | Interactions with other proteins (96 interactors) |
| Partner (UniProt) | IntAct | Confidence score | |
| O15169 | Axin-1 (Axis inhibition protein 1) (hAxin) | EBI-731365 | 0.00 |
| O60763 | General vesicular transport factor p115 (Protein USO1 homolog) (Transcytosis-associated protein) (TAP) (Vesicle-docking protein) | EBI-759358 | 0.37 |
| P10275 | Androgen receptor (Dihydrotestosterone receptor) (Nuclear receptor subfamily 3 group C member 4) | EBI-1632203 | 0.37 |
| Q9Q2G4 | V-1 protease | EBI-6174875 | 0.35 |
| Q9NQ11 | Polyamine-transporting ATPase 13A2 (EC 7.6.2.-) | EBI-6377262 | 0.51 |
| Q5S007 | Leucine-rich repeat serine/threonine-protein kinase 2 (EC 2.7.11.1) (EC 3.6.5.-) (Dardarin) | EBI-9247177 | 0.79 |
| P11142 | Heat shock cognate 71 kDa protein (EC 3.6.4.10) (Heat shock 70 kDa protein 8) (Lipopolysaccharide-associated protein 1) (LAP-1) (LPS-associated protein 1) | EBI-9655962 | 0.69 |
| Q9UL15 | BAG family molecular chaperone regulator 5 (BAG-5) (Bcl-2-associated athanogene 5) | EBI-9655962 | 0.35 |
| Q38SD2 | Leucine-rich repeat serine/threonine-protein kinase 1 (EC 2.7.11.1) | EBI-9659083 | 0.44 |
| Q76MZ3 | Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform (PP2A subunit A isoform PR65-alpha) (PP2A subunit A isoform R1-alpha) | EBI-10991736 | 0.35 |
| A2AUM9 | Centrosomal protein of 152 kDa (Cep152) | EBI-10994361 | 0.35 |
| P10126 | Elongation factor 1-alpha 1 (EF-1-alpha-1) (Elongation factor Tu) (EF-Tu) (Eukaryotic elongation factor 1 A-1) (eEF1A-1) | EBI-11048962 | 0.35 |
| G3X972 | Sec24-related gene family, member C (S. cerevisiae) | EBI-11079358 | 0.35 |
| P09497 | Clathrin light chain B (Lcb) | EBI-11081190 | 0.35 |
| Q9NYZ3 | G2 and S phase-expressed protein 1 (GTSE-1) (Protein B99 homolog) | EBI-11081743 | 0.35 |
| Q13492 | Phosphatidylinositol-binding clathrin assembly protein (Clathrin assembly lymphoid myeloid leukemia protein) | EBI-11082344 | 0.35 |
| Q00610 | Clathrin heavy chain 1 (Clathrin heavy chain on chromosome 17) (CLH-17) | EBI-11082478 | 0.35 |
| Q9Z1Z0 | General vesicular transport factor p115 (Protein USO1 homolog) (Transcytosis-associated protein) (TAP) (Vesicle-docking protein) | EBI-11112182 | 0.35 |
| P15735 | Phosphorylase b kinase gamma catalytic chain, liver/testis isoform (PHK-gamma-LT) (PHK-gamma-T) (EC 2.7.11.19) (PSK-C3) (Phosphorylase kinase subunit gamma-2) | EBI-11135895 | 0.35 |
| P51805 | Plexin-A3 (Plexin-4) (Semaphorin receptor SEX) | EBI-11150908 | 0.35 |
| Q96CW1 | AP-2 complex subunit mu (AP-2 mu chain) (Adaptin-mu2) (Adaptor protein complex AP-2 subunit mu) (Adaptor-related protein complex 2 subunit mu) (Clathrin assembly protein complex 2 mu medium chain) (Clathrin coat assembly protein AP50) (Clathrin coat-associated protein AP50) (HA2 50 kDa subunit) (Plasma membrane adaptor AP-2 50 kDa protein) | EBI-11150908 | 0.35 |
| Q9H2Y7 | Zinc finger protein 106 (Zfp-106) (Zinc finger protein 474) | EBI-11150908 | 0.35 |
| Q5TB80 | Centrosomal protein of 162 kDa (Cep162) (Protein QN1 homolog) | EBI-11150908 | 0.35 |
| Q8TEH3 | DENN domain-containing protein 1A (Connecdenn 1) (Connecdenn) (Protein FAM31A) | EBI-11150908 | 0.35 |
| Q8N684 | Cleavage and polyadenylation specificity factor subunit 7 (Cleavage and polyadenylation specificity factor 59 kDa subunit) (CPSF 59 kDa subunit) (Cleavage factor Im complex 59 kDa subunit) (CFIm59) (Pre-mRNA cleavage factor Im 59 kDa subunit) | EBI-11150908 | 0.35 |
| Q9Y496 | Kinesin-like protein KIF3A (Microtubule plus end-directed kinesin motor 3A) | EBI-11150908 | 0.35 |
| Q14789 | Golgin subfamily B member 1 (372 kDa Golgi complex-associated protein) (GCP372) (Giantin) (Macrogolgin) | EBI-11150908 | 0.35 |
| Q2M2I8 | AP2-associated protein kinase 1 (EC 2.7.11.1) (Adaptor-associated kinase 1) | EBI-11150908 | 0.35 |
| Q8N556 | Actin filament-associated protein 1 (110 kDa actin filament-associated protein) (AFAP-110) | EBI-11150908 | 0.35 |
| O43175 | D-3-phosphoglycerate dehydrogenase (3-PGDH) (EC 1.1.1.95) (2-oxoglutarate reductase) (EC 1.1.1.399) (Malate dehydrogenase) (EC 1.1.1.37) | EBI-11150908 | 0.35 |
| P47756 | F-actin-capping protein subunit beta (CapZ beta) | EBI-11150908 | 0.35 |
| P27482 | Calmodulin-like protein 3 (CaM-like protein) (CLP) (Calmodulin-related protein NB-1) | EBI-11150908 | 0.35 |
| P53992 | Protein transport protein Sec24C (SEC24-related protein C) | EBI-11150908 | 0.35 |
| Q9UHB6 | LIM domain and actin-binding protein 1 (Epithelial protein lost in neoplasm) | EBI-11150908 | 0.35 |
| P49757 | Protein numb homolog (h-Numb) (Protein S171) | EBI-11150908 | 0.35 |
| Q9ULH0 | Kinase D-interacting substrate of 220 kDa (Ankyrin repeat-rich membrane-spanning protein) | EBI-11150908 | 0.35 |
| P42566 | Epidermal growth factor receptor substrate 15 (Protein Eps15) (Protein AF-1p) | EBI-11150908 | 0.35 |
| Q13813 | Spectrin alpha chain, non-erythrocytic 1 (Alpha-II spectrin) (Fodrin alpha chain) (Spectrin, non-erythroid alpha subunit) | EBI-11150908 | 0.35 |
| Q96PK6 | RNA-binding protein 14 (Paraspeckle protein 2) (PSP2) (RNA-binding motif protein 14) (RRM-containing coactivator activator/modulator) (Synaptotagmin-interacting protein) (SYT-interacting protein) | EBI-11150908 | 0.35 |
| E9PK67 | Poly [ADP-ribose] polymerase (PARP) (EC 2.4.2.-) | EBI-11150908 | 0.35 |
| Q96FJ0 | AMSH-like protease (AMSH-LP) (EC 3.4.19.-) (STAM-binding protein-like 1) | EBI-11150908 | 0.53 |
| Q8IVT2 | Mitotic interactor and substrate of PLK1 (Mitotic spindle positioning protein) | EBI-11150908 | 0.35 |
| P53675 | Clathrin heavy chain 2 (Clathrin heavy chain on chromosome 22) (CLH-22) | EBI-11150908 | 0.35 |
| P09496 | Clathrin light chain A (Lca) | EBI-11150908 | 0.35 |
| P08047 | Transcription factor Sp1 | EBI-11150908 | 0.35 |
| Q9H0K6 | Pseudouridylate synthase PUS7L (EC 5.4.99.-) (Pseudouridylate synthase 7 homolog-like protein) | EBI-11150908 | 0.35 |
| Q8WXE9 | Stonin-2 (Stoned B) | EBI-11150908 | 0.35 |
| P14384 | Carboxypeptidase M (CPM) (EC 3.4.17.12) | EBI-11150908 | 0.35 |
| P28066 | Proteasome subunit alpha type-5 (Macropain zeta chain) (Multicatalytic endopeptidase complex zeta chain) (Proteasome zeta chain) | EBI-11150908 | 0.35 |
| Q3B7T1 | Erythroid differentiation-related factor 1 | EBI-11150908 | 0.35 |
| Q6ZRV2 | Protein FAM83H | EBI-11150908 | 0.35 |
| Q9UBH6 | Xenotropic and polytropic retrovirus receptor 1 (Protein SYG1 homolog) (Xenotropic and polytropic murine leukemia virus receptor X3) (X-receptor) | EBI-11150908 | 0.35 |
| O00159 | Unconventional myosin-Ic (Myosin I beta) (MMI-beta) (MMIb) | EBI-11150908 | 0.35 |
| Q16643 | Drebrin (Developmentally-regulated brain protein) | EBI-11150908 | 0.35 |
| Q5T0W9 | Protein FAM83B | EBI-11150908 | 0.35 |
| O00443 | Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha (PI3K-C2-alpha) (PtdIns-3-kinase C2 subunit alpha) (EC 2.7.1.137) (EC 2.7.1.153) (EC 2.7.1.154) (Phosphoinositide 3-kinase-C2-alpha) | EBI-11150908 | 0.35 |
| H0YEF7 | Phosphatidylinositol-binding clathrin assembly protein | EBI-11150908 | 0.35 |
| Q9NSY1 | BMP-2-inducible protein kinase (BIKe) (EC 2.7.11.1) | EBI-11150908 | 0.35 |
| F5GWT4 | Non-specific serine/threonine protein kinase (EC 2.7.11.1) | EBI-11150908 | 0.35 |
| Q8N3V7 | Synaptopodin | EBI-11150908 | 0.35 |
| P62158 | Calmodulin-1 | EBI-11150908 | 0.35 |
| Q9UK73 | Protein fem-1 homolog B (FEM1b) (FEM1-beta) (Fem-1-like death receptor-binding protein alpha) (Fem-1-like in apoptotic pathway protein alpha) (F1A-alpha) | EBI-11150908 | 0.35 |
| P63010 | AP-2 complex subunit beta (AP105B) (Adaptor protein complex AP-2 subunit beta) (Adaptor-related protein complex 2 subunit beta) (Beta-2-adaptin) (Beta-adaptin) (Clathrin assembly protein complex 2 beta large chain) (Plasma membrane adaptor HA2/AP2 adaptin beta subunit) | EBI-11150908 | 0.35 |
| O94973 | AP-2 complex subunit alpha-2 (100 kDa coated vesicle protein C) (Adaptor protein complex AP-2 subunit alpha-2) (Adaptor-related protein complex 2 subunit alpha-2) (Alpha-adaptin C) (Alpha2-adaptin) (Clathrin assembly protein complex 2 alpha-C large chain) (Huntingtin yeast partner J) (Huntingtin-interacting protein 9) (HIP-9) (Huntingtin-interacting protein J) (Plasma membrane adaptor HA2/AP2 adaptin alpha C subunit) | EBI-11150908 | 0.35 |
| Q13470 | Non-receptor tyrosine-protein kinase TNK1 (EC 2.7.10.2) (CD38 negative kinase 1) | EBI-11150908 | 0.35 |
| Q8TDG2 | Actin-related protein T1 (ARP-T1) | EBI-11150908 | 0.35 |
| O00291 | Huntingtin-interacting protein 1 (HIP-1) (Huntingtin-interacting protein I) (HIP-I) | EBI-11150908 | 0.35 |
| O95782 | AP-2 complex subunit alpha-1 (100 kDa coated vesicle protein A) (Adaptor protein complex AP-2 subunit alpha-1) (Adaptor-related protein complex 2 subunit alpha-1) (Alpha-adaptin A) (Alpha1-adaptin) (Clathrin assembly protein complex 2 alpha-A large chain) (Plasma membrane adaptor HA2/AP2 adaptin alpha A subunit) | EBI-11150908 | 0.35 |
| Q9BY43 | Charged multivesicular body protein 4a (Chromatin-modifying protein 4a) (CHMP4a) (SNF7 homolog associated with Alix-2) (SNF7-1) (hSnf-1) (Vacuolar protein sorting-associated protein 32-1) (Vps32-1) (hVps32-1) | EBI-11150908 | 0.35 |
| P98082 | Disabled homolog 2 (Adaptor molecule disabled-2) (Differentially expressed in ovarian carcinoma 2) (DOC-2) (Differentially-expressed protein 2) | EBI-11150908 | 0.35 |
| P29703 | Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha (PFTase/PGGTase I alpha) (EC 2.5.1.58) (EC 2.5.1.59) (CAAX farnesyltransferase subunit alpha) (FTase-alpha) (Ras proteins prenyltransferase subunit alpha) (Type I protein geranyl-geranyltransferase subunit alpha) (GGTase-I-alpha) | EBI-11525188 | 0.56 |
| P56945 | Breast cancer anti-estrogen resistance protein 1 (CRK-associated substrate) (Cas scaffolding protein family member 1) (p130cas) | EBI-15099463 | 0.35 |
| Q8IWL3 | Iron-sulfur cluster co-chaperone protein HscB (DnaJ homolog subfamily C member 20) [Cleaved into: Iron-sulfur cluster co-chaperone protein HscB, cytoplasmic (C-HSC20); Iron-sulfur cluster co-chaperone protein HscB, mitochondrial] | EBI-13943458 | 0.35 |
| Q6IQ23 | Pleckstrin homology domain-containing family A member 7 (PH domain-containing family A member 7) | EBI-16398399 | 0.35 |
| Q8TBP5 | Membrane protein FAM174A (Hepatitis C virus NS5A-transactivated protein 6) (HCV NS5A-transactivated protein 6) (Transmembrane protein 157) | EBI-21502646 | 0.35 |
| Q9P296 | C5a anaphylatoxin chemotactic receptor 2 (Complement component 5a receptor 2) (G-protein coupled receptor 77) | EBI-21519943 | 0.35 |
| Q8N3R9 | Protein PALS1 (MAGUK p55 subfamily member 5) (Membrane protein, palmitoylated 5) (Protein associated with Lin-7 1) | EBI-21627185 | 0.35 |
| Q9UJ41 | Rab5 GDP/GTP exchange factor (RAP1) (Rabaptin-5-associated exchange factor for Rab5) (Rabex-5) | EBI-21644136 | 0.35 |
| O95630 | STAM-binding protein (EC 3.4.19.-) (Associated molecule with the SH3 domain of STAM) (Endosome-associated ubiquitin isopeptidase) | EBI-21667922 | 0.35 |
| Q9NZL4 | Hsp70-binding protein 1 (HspBP1) (Heat shock protein-binding protein 1) (Hsp70-binding protein 2) (HspBP2) (Hsp70-interacting protein 1) (Hsp70-interacting protein 2) | EBI-21711136 | 0.35 |
| Q09019 | Dystrophia myotonica WD repeat-containing protein (Dystrophia myotonica-containing WD repeat motif protein) (Protein 59) (Protein DMR-N9) | EBI-21714883 | 0.35 |
| Q9ULV8 | E3 ubiquitin-protein ligase CBL-C (EC 2.3.2.27) (RING finger protein 57) (RING-type E3 ubiquitin transferase CBL-C) (SH3-binding protein CBL-3) (SH3-binding protein CBL-C) (Signal transduction protein CBL-C) | EBI-21715242 | 0.35 |
| Q8N2M8 | CLK4-associating serine/arginine rich protein (Splicing factor, arginine/serine-rich 16) (Suppressor of white-apricot homolog 2) | EBI-21714908 | 0.35 |
| Q96SL4 | Glutathione peroxidase 7 (GPx-7) (GSHPx-7) (EC 1.11.1.9) (CL683) | EBI-21714987 | 0.35 |
| Q9NSE4 | Isoleucine--tRNA ligase, mitochondrial (EC 6.1.1.5) (Isoleucyl-tRNA synthetase) (IleRS) | EBI-21715157 | 0.35 |
| Q01968 | Inositol polyphosphate 5-phosphatase OCRL (EC 3.1.3.36) (EC 3.1.3.56) (Inositol polyphosphate 5-phosphatase OCRL-1) (OCRL-1) (Lowe oculocerebrorenal syndrome protein) (Phosphatidylinositol 3,4,5-triphosphate 5-phosphatase) (EC 3.1.3.86) | EBI-16412116 | 0.35 |
| Q9Y6W8 | Inducible T-cell costimulator (Activation-inducible lymphocyte immunomediatory molecule) (CD antigen CD278) | EBI-16721689 | 0.35 |
| O43493 | Trans-Golgi network integral membrane protein 2 (Trans-Golgi network glycoprotein 46) (TGN38 homolog) (hTGN46) (Trans-Golgi network glycoprotein 48) (hTGN48) (Trans-Golgi network glycoprotein 51) (hTGN51) (Trans-Golgi network protein 2) | EBI-16800265 | 0.27 |
| Q9Y4C4 | Malignant fibrous histiocytoma-amplified sequence 1 (Malignant fibrous histiocytoma-amplified sequence with leucine-rich tandem repeats 1) | EBI-20590176 | 0.44 |
| Q9Y586 | Protein mab-21-like 2 | EBI-21261050 | 0.35 |
| P49023 | Paxillin | EBI-25376663 | 0.35 |
| Q9C0B5 | Palmitoyltransferase ZDHHC5 (EC 2.3.1.225) (Zinc finger DHHC domain-containing protein 5) (DHHC-5) (Zinc finger protein 375) | EBI-25637382 | 0.35 |
| P51617 | Interleukin-1 receptor-associated kinase 1 (IRAK-1) (EC 2.7.11.1) | EBI-28935882 | 0.35 |
| Q9BYP7 | Serine/threonine-protein kinase WNK3 (EC 2.7.11.1) (Protein kinase lysine-deficient 3) (Protein kinase with no lysine 3) | EBI-28946054 | 0.35 |
| P31947 | 14-3-3 protein sigma (Epithelial cell marker protein 1) (Stratifin) | EBI-30814567 | 0.44 |
| P04637 | Cellular tumor antigen p53 (Antigen NY-CO-13) (Phosphoprotein p53) (Tumor suppressor p53) | EBI-34581131 | 0.35 |
Database | Links |
| UNIPROT | O14976 Q5U4P5 Q9BVY6 |
| PDB | 4C57 4C58 4C59 4O38 4Y8D 5Y7Z 5Y80 |
| Pfam | PF00069 PF10409 |
| PROSITE | PS51182 PS50076 PS51181 PS50011 PS00108 |
| OMIM | 602052 |
| DisGeNET | 2580 |
National and Kapodistrian University of Athens
Department of Biology
Biophysics & Bioinformatics Laboratory