Protein Information |
|
---|---|
Protein Name | Serine/threonine-protein kinase 16 |
Accession Code | O75716 |
Gene | STK16 |
Organism | Homo sapiens | Human (Taxonomy: 9606) |
Part of Reference Proteome? | Yes |
Sequence (Length: 305) | |
MGHALCVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGLHDGHFYALKRILCHEQQDREEAQREADMHRLFNHPNILRL VAYCLRERGAKHEAWLLLPFFKRGTLWNEIERLKDKGNFLTEDQILWLLLGICRGLEAIHAKGYAHRDLKPTNILLGDEG QPVLMDLGSMNQACIHVEGSRQALTLQDWAAQRCTISYRAPELFSVQSHCVIDERTDVWSLGCVLYAMMFGEGPYDMVFQ KGDSVALAVQNQLSIPQSPRHSSALRQLLNSMMTVDPHQRPHIPLLLSQLEALQPPAPGQHTTQI |
Structure Viewer (PDB: 2BUJ) |
---|
Description |
||
---|---|---|
Cytoplasm, perinuclear region. Membrane {By Similarity}; Lipid-anchor {By Similarity}. Note=Associates with Golgi and Golgi-derived vesicles. {By Similarity}. | Position in the Nuclear Envelope |
|
Location | Location ID | Description |
Perinuclear Region | SL-0198 | The perinuclear region is the cytoplasmic region just around the nucleus. | Membrane Topology |
Topology | Source | Annotation Type |
Lipid-Anchored | UniProt | Curator Inference {ECO:0000305|PubMed:10364453} | Assigned Ontology terms |
Cellular Component | Cytoplasm (GO:0005737) Cytosol (GO:0005829) Golgi Apparatus (GO:0005794) Golgi-Associated Vesicle (GO:0005798) Nucleoplasm (GO:0005654) Perinuclear Region Of Cytoplasm (GO:0048471) Plasma Membrane (GO:0005886) |
Description |
|
---|---|
Membrane-associated protein kinase that phosphorylates on serine and threonine residues. In vitro substrates include DRG1, ENO1 and EIF4EBP1. Also autophosphorylates. May be involved in secretory vesicle trafficking or intracellular signaling. May have a role in regulating stromal-epithelial interactions that occur during ductal morphogenesis in the mammary gland. May be involved in TGF-beta signaling. Able to autophosphorylate on Tyr residue; it is however unclear whether it has tyrosine-protein kinase toward other proteins. {Experimental EvidencePubMed:10364453}. | Assigned Ontology terms |
Biological Process | Cellular Response To Transforming Growth Factor Beta Stimulus (GO:0071560) Positive Regulation Of Transcription By RNA Polymerase II (GO:0045944) Protein Autophosphorylation (GO:0046777) |
Molecular Function | ATP Binding (GO:0005524) Non-Membrane Spanning Protein Tyrosine Kinase Activity (GO:0004715) Protein Serine Kinase Activity (GO:0106310) Protein Serine/Threonine Kinase Activity (GO:0004674) RNA Polymerase II Cis-Regulatory Region Sequence-Specific DNA Binding (GO:0000978) |
Interactions with Nuclear Envelope proteins (3 interactors) |
|||
---|---|---|---|
Partner (NucEnvDB) | IntAct | Confidence score | |
Q13137 | Calcium-binding and coiled-coil domain-containing protein 2 | EBI-10189253 | 0.56 |
Q8IWX8 | Calcium homeostasis endoplasmic reticulum protein | EBI-28931389 | 0.35 |
O15162 | Phospholipid scramblase 1 | EBI-10189073 | 0.56 | Interactions with other proteins (110 interactors) |
Partner (UniProt) | IntAct | Confidence score | |
P49247 | Ribose-5-phosphate isomerase (EC 5.3.1.6) (Phosphoriboisomerase) | EBI-757201 | 0.67 |
Q8N5Z5 | BTB/POZ domain-containing protein KCTD17 | EBI-757423 | 0.78 |
Q6UY14 | ADAMTS-like protein 4 (ADAMTSL-4) (Thrombospondin repeat-containing protein 1) | EBI-757837 | 0.62 |
Q15583 | Homeobox protein TGIF1 (5'-TG-3'-interacting factor 1) | EBI-1060072 | 0.00 |
Q05084 | Islet cell autoantigen 1 (69 kDa islet cell autoantigen) (ICA69) (Islet cell autoantigen p69) (ICAp69) (p69) | EBI-1061392 | 0.00 |
Q9NRH2 | SNF-related serine/threonine-protein kinase (EC 2.7.11.1) (SNF1-related kinase) | EBI-1063140 | 0.00 |
O75116 | Rho-associated protein kinase 2 (EC 2.7.11.1) (Rho kinase 2) (Rho-associated, coiled-coil-containing protein kinase 2) (Rho-associated, coiled-coil-containing protein kinase II) (ROCK-II) (p164 ROCK-2) | EBI-1066240 | 0.00 |
P26441 | Ciliary neurotrophic factor (CNTF) | EBI-1066319 | 0.00 |
Q96RG2 | PAS domain-containing serine/threonine-protein kinase (PAS-kinase) (PASKIN) (hPASK) (EC 2.7.11.1) | EBI-1067304 | 0.00 |
P63162 | Small nuclear ribonucleoprotein-associated protein N (snRNP-N) (Sm protein D) (Sm-D) (Sm protein N) (Sm-N) (SmN) (Tissue-specific-splicing protein) | EBI-1070450 | 0.00 |
Q93063 | Exostosin-2 (EC 2.4.1.224) (EC 2.4.1.225) (Glucuronosyl-N-acetylglucosaminyl-proteoglycan/N-acetylglucosaminyl-proteoglycan 4-alpha-N-acetylglucosaminyltransferase) (Multiple exostoses protein 2) (Putative tumor suppressor protein EXT2) | EBI-1070470 | 0.00 |
P41235 | Hepatocyte nuclear factor 4-alpha (HNF-4-alpha) (Nuclear receptor subfamily 2 group A member 1) (Transcription factor 14) (TCF-14) (Transcription factor HNF-4) | EBI-1071104 | 0.00 |
P40337 | von Hippel-Lindau disease tumor suppressor (Protein G7) (pVHL) | EBI-1074035 | 0.00 |
Q9HB66 | Alternative protein MKKS (McKusick-Kaufman syndrome, isoform CRA_a) (Molecular chaperone MKKS) (PNAS-117) | EBI-1075221 | 0.00 |
Q14680 | Maternal embryonic leucine zipper kinase (hMELK) (EC 2.7.11.1) (Protein kinase Eg3) (pEg3 kinase) (Protein kinase PK38) (hPK38) (Tyrosine-protein kinase MELK) (EC 2.7.10.2) | EBI-1078077 | 0.00 |
Q14164 | Inhibitor of nuclear factor kappa-B kinase subunit epsilon (I-kappa-B kinase epsilon) (IKK-E) (IKK-epsilon) (IkBKE) (EC 2.7.11.10) (Inducible I kappa-B kinase) (IKK-i) | EBI-1078621 | 0.00 |
Q6P2I7 | Endogenous Bornavirus-like nucleoprotein 2 (Endogenous Borna-like N element-2) (EBLN-2) | EBI-1084989 | 0.00 |
Q8N5R6 | Coiled-coil domain-containing protein 33 (Cancer/testis antigen 61) (CT61) | EBI-8639058 | 0.37 |
P67870 | Casein kinase II subunit beta (CK II beta) (Phosvitin) (Protein G5a) | EBI-7136780 | 0.37 |
Q8IWZ5 | Tripartite motif-containing protein 42 | EBI-10189041 | 0.72 |
P50222 | Homeobox protein MOX-2 (Growth arrest-specific homeobox) (Mesenchyme homeobox 2) | EBI-10189051 | 0.56 |
Q8IYX7 | Stabilizer of axonemal microtubules 1 | EBI-10189061 | 0.72 |
O43186 | Cone-rod homeobox protein | EBI-10189085 | 0.56 |
O43597 | Protein sprouty homolog 2 (Spry-2) | EBI-10189095 | 0.56 |
O43734 | E3 ubiquitin ligase TRAF3IP2 (EC 2.3.2.27) (Adapter protein CIKS) (Connection to IKK and SAPK/JNK) (E3 ubiquitin-protein ligase CIKS) (Nuclear factor NF-kappa-B activator 1) (ACT1) (TRAF3-interacting protein 2) | EBI-10189107 | 0.56 |
O95967 | EGF-containing fibulin-like extracellular matrix protein 2 (Fibulin-4) (FIBL-4) (Protein UPH1) | EBI-10189117 | 0.72 |
P12757 | Ski-like protein (Ski-related oncogene) (Ski-related protein) | EBI-10189127 | 0.56 |
P14373 | Zinc finger protein RFP (EC 2.3.2.27) (RING finger protein 76) (RING-type E3 ubiquitin transferase TRIM27) (Ret finger protein) (Tripartite motif-containing protein 27) | EBI-10189139 | 0.56 |
P15884 | Transcription factor 4 (TCF-4) (Class B basic helix-loop-helix protein 19) (bHLHb19) (Immunoglobulin transcription factor 2) (ITF-2) (SL3-3 enhancer factor 2) (SEF-2) | EBI-10189151 | 0.56 |
P60370 | Keratin-associated protein 10-5 (High sulfur keratin-associated protein 10.5) (Keratin-associated protein 10.5) (Keratin-associated protein 18-5) (Keratin-associated protein 18.5) | EBI-10189177 | 0.56 |
P60409 | Keratin-associated protein 10-7 (High sulfur keratin-associated protein 10.7) (Keratin-associated protein 10.7) (Keratin-associated protein 18-7) (Keratin-associated protein 18.7) | EBI-10189187 | 0.56 |
P60410 | Keratin-associated protein 10-8 (High sulfur keratin-associated protein 10.8) (Keratin-associated protein 10.8) (Keratin-associated protein 18-8) (Keratin-associated protein 18.8) | EBI-10189197 | 0.72 |
P60411 | Keratin-associated protein 10-9 (High sulfur keratin-associated protein 10.9) (Keratin-associated protein 10.9) (Keratin-associated protein 18-9) (Keratin-associated protein 18.9) | EBI-10189209 | 0.56 |
Q04864 | Proto-oncogene c-Rel | EBI-10189221 | 0.56 |
Q08117 | TLE family member 5 (Amino-terminal enhancer of split) (Amino enhancer of split) (Gp130-associated protein GAM) (Grg-5) (Groucho-related protein 5) (Protein ESP1) (Protein GRG) (TLE family member 5, transcriptional modulator) | EBI-10189231 | 0.56 |
Q0VD86 | Protein INCA1 (Inhibitor of CDK interacting with cyclin A1) | EBI-10189241 | 0.72 |
Q13829 | BTB/POZ domain-containing adapter for CUL3-mediated RhoA degradation protein 2 (hBACURD2) (BTB/POZ domain-containing protein TNFAIP1) (Protein B12) (Tumor necrosis factor, alpha-induced protein 1, endothelial) | EBI-10189263 | 0.56 |
Q15654 | Thyroid receptor-interacting protein 6 (TR-interacting protein 6) (TRIP-6) (Opa-interacting protein 1) (OIP-1) (Zyxin-related protein 1) (ZRP-1) | EBI-10189275 | 0.56 |
Q5JR59 | Microtubule-associated tumor suppressor candidate 2 (Cardiac zipper protein) (Microtubule plus-end tracking protein TIP150) (Tracking protein of 150 kDa) | EBI-10189289 | 0.56 |
Q5JST6 | EF-hand domain-containing family member C2 | EBI-10189301 | 0.56 |
Q5JXC2 | Migration and invasion-inhibitory protein (IGFBP2-binding protein) (Invasion-inhibitory protein 45) (IIp45) | EBI-10189313 | 0.67 |
Q6PEX3 | Keratin-associated protein 26-1 | EBI-10189325 | 0.56 |
Q7Z3S9 | Notch homolog 2 N-terminal-like protein A (Notch homolog 2 N-terminal-like protein) | EBI-10189344 | 0.56 |
Q8HWS3 | DNA-binding protein RFX6 (Regulatory factor X 6) (Regulatory factor X domain-containing protein 1) | EBI-10189356 | 0.56 |
Q92824 | Proprotein convertase subtilisin/kexin type 5 (EC 3.4.21.-) (Proprotein convertase 5) (PC5) (Proprotein convertase 6) (PC6) (hPC6) (Subtilisin/kexin-like protease PC5) | EBI-10189400 | 0.56 |
Q96EY1 | DnaJ homolog subfamily A member 3, mitochondrial (DnaJ protein Tid-1) (hTid-1) (Hepatocellular carcinoma-associated antigen 57) (Tumorous imaginal discs protein Tid56 homolog) | EBI-10189410 | 0.56 |
Q96Q35 | Flagellum-associated coiled-coil domain-containing protein 1 (Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 12 protein) | EBI-10189422 | 0.56 |
Q99081 | Transcription factor 12 (TCF-12) (Class B basic helix-loop-helix protein 20) (bHLHb20) (DNA-binding protein HTF4) (E-box-binding protein) (Transcription factor HTF-4) | EBI-10189434 | 0.56 |
Q9BQ13 | BTB/POZ domain-containing protein KCTD14 | EBI-10189446 | 0.67 |
Q9GZT8 | NIF3-like protein 1 (Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 1 protein) | EBI-10189463 | 0.56 |
Q9NRY6 | Phospholipid scramblase 3 (PL scramblase 3) (Ca(2+)-dependent phospholipid scramblase 3) | EBI-10189475 | 0.72 |
Q9UKT9 | Zinc finger protein Aiolos (Ikaros family zinc finger protein 3) | EBI-10189487 | 0.56 |
Q9Y295 | Developmentally-regulated GTP-binding protein 1 (DRG-1) (Neural precursor cell expressed developmentally down-regulated protein 3) (NEDD-3) (Translation factor GTPase DRG1) (TRAFAC GTPase DRG1) (EC 3.6.5.-) | EBI-10325852 | 0.56 |
Q8XC86 | EspB (T3SS translocator EspB) | EBI-10038684 | 0.37 |
Q7DB77 | Translocated intimin receptor Tir (Secreted effector protein Tir) | EBI-10039518 | 0.51 |
B7UM99 | Translocated intimin receptor Tir (Secreted effector protein Tir) | EBI-10040304 | 0.37 |
Q13185 | Chromobox protein homolog 3 (HECH) (Heterochromatin protein 1 homolog gamma) (HP1 gamma) (Modifier 2 protein) | EBI-24281792 | 0.56 |
A8MQ03 | Cysteine-rich tail protein 1 | EBI-24308246 | 0.56 |
P0DPK4 | Notch homolog 2 N-terminal-like protein C | EBI-24330984 | 0.56 |
Q7Z3K6 | Mesoderm induction early response protein 3 (Mi-er3) | EBI-24336466 | 0.56 |
Q70EL1 | Inactive ubiquitin carboxyl-terminal hydrolase 54 (Inactive ubiquitin-specific peptidase 54) | EBI-24353346 | 0.56 |
Q9NQX0 | Putative histone-lysine N-methyltransferase PRDM6 (EC 2.1.1.361) (PR domain zinc finger protein 6) (PR domain-containing protein 6) | EBI-24363537 | 0.56 |
Q8IUG1 | Keratin-associated protein 1-3 (Keratin-associated protein 1.8) (Keratin-associated protein 1.9) | EBI-25258808 | 0.56 |
Q96KN3 | Homeobox protein PKNOX2 (Homeobox protein PREP-2) (PBX/knotted homeobox 2) | EBI-25259197 | 0.56 |
Q9Y3S2 | Zinc finger protein 330 (Nucleolar autoantigen 36) (Nucleolar cysteine-rich protein) | EBI-24486018 | 0.56 |
P51114 | RNA-binding protein FXR1 (FMR1 autosomal homolog 1) (hFXR1p) | EBI-24486544 | 0.56 |
P31321 | cAMP-dependent protein kinase type I-beta regulatory subunit | EBI-24491334 | 0.56 |
O95994 | Anterior gradient protein 2 homolog (AG-2) (hAG-2) (HPC8) (Secreted cement gland protein XAG-2 homolog) | EBI-24509792 | 0.56 |
Q2I0M5 | R-spondin-4 (Roof plate-specific spondin-4) (hRspo4) | EBI-24516412 | 0.56 |
O15496 | Group 10 secretory phospholipase A2 (EC 3.1.1.4) (Group X secretory phospholipase A2) (GX sPLA2) (sPLA2-X) (Phosphatidylcholine 2-acylhydrolase 10) | EBI-24522989 | 0.56 |
Q96D03 | DNA damage-inducible transcript 4-like protein (HIF-1 responsive protein RTP801-like) (Protein regulated in development and DNA damage response 2) (REDD-2) | EBI-24524948 | 0.56 |
Q9HBZ2 | Aryl hydrocarbon receptor nuclear translocator 2 (ARNT protein 2) (Class E basic helix-loop-helix protein 1) (bHLHe1) | EBI-24529669 | 0.56 |
A8MUP2 | Citrate synthase-lysine N-methyltransferase CSKMT, mitochondrial (CS-KMT) (EC 2.1.1.-) (Methyltransferase-like protein 12, mitochondrial) | EBI-24619225 | 0.56 |
Q03431 | Parathyroid hormone/parathyroid hormone-related peptide receptor (PTH/PTHrP type I receptor) (PTH/PTHr receptor) (Parathyroid hormone 1 receptor) (PTH1 receptor) | EBI-24625735 | 0.56 |
Q8IUC1 | Keratin-associated protein 11-1 (High sulfur keratin-associated protein 11.1) | EBI-24630962 | 0.56 |
Q93015 | N-alpha-acetyltransferase 80 (HsNAAA80) (EC 2.3.1.-) (N-acetyltransferase 6) (Protein fusion-2) (Protein fus-2) | EBI-24640795 | 0.56 |
Q06546 | GA-binding protein alpha chain (GABP subunit alpha) (Nuclear respiratory factor 2 subunit alpha) (Transcription factor E4TF1-60) | EBI-24716574 | 0.56 |
Q6NX45 | Zinc finger protein 774 | EBI-25275432 | 0.56 |
O14508 | Suppressor of cytokine signaling 2 (SOCS-2) (Cytokine-inducible SH2 protein 2) (CIS-2) (STAT-induced STAT inhibitor 2) (SSI-2) | EBI-23924597 | 0.56 |
Q52LG2 | Keratin-associated protein 13-2 | EBI-24408520 | 0.56 |
Q07627 | Keratin-associated protein 1-1 (High sulfur keratin-associated protein 1.1) (Keratin-associated protein 1.1) (Keratin-associated protein 1.6) (Keratin-associated protein 1.7) | EBI-24428974 | 0.56 |
Q15323 | Keratin, type I cuticular Ha1 (Hair keratin, type I Ha1) (Keratin-31) (K31) | EBI-24437382 | 0.56 |
Q5T749 | Keratinocyte proline-rich protein (hKPRP) | EBI-24469802 | 0.56 |
P27918 | Properdin (Complement factor P) | EBI-24556586 | 0.56 |
Q9Y6H3 | Mitochondrial inner membrane protease ATP23 homolog (EC 3.4.24.-) (Ku70-binding protein 3) (XRCC6-binding protein 1) | EBI-24559916 | 0.56 |
O43559 | Fibroblast growth factor receptor substrate 3 (FGFR substrate 3) (FGFR-signaling adaptor SNT2) (Suc1-associated neurotrophic factor target 2) (SNT-2) | EBI-24586436 | 0.56 |
Q7RTU4 | Class A basic helix-loop-helix protein 9 (bHLHa9) (Class F basic helix-loop-helix factor 42) (bHLHf42) | EBI-24593098 | 0.56 |
Q6P1L6 | Zinc finger protein 343 | EBI-24603190 | 0.56 |
Q9BS75 | KLHL20 protein (Kelch-like 20 (Drosophila), isoform CRA_a) | EBI-24604089 | 0.56 |
Q9Y4P1 | Cysteine protease ATG4B (EC 3.4.22.-) (AUT-like 1 cysteine endopeptidase) (Autophagy-related cysteine endopeptidase 1) (Autophagin-1) (Autophagy-related protein 4 homolog B) (HsAPG4B) (hAPG4B) | EBI-21856478 | 0.35 |
Q96GV9 | Macrophage immunometabolism regulator | EBI-21856478 | 0.35 |
Q8WVV4 | Protein POF1B (Premature ovarian failure protein 1B) | EBI-21856478 | 0.35 |
Q6ZVX7 | F-box only protein 50 (NCC receptor protein 1 homolog) (NCCRP-1) (Non-specific cytotoxic cell receptor protein 1 homolog) | EBI-21856478 | 0.35 |
Q6BDS2 | UHRF1-binding protein 1 (ICBP90-binding protein 1) (Ubiquitin-like containing PHD and RING finger domains 1-binding protein 1) | EBI-21856478 | 0.35 |
Q5QP82 | DDB1- and CUL4-associated factor 10 (WD repeat-containing protein 32) | EBI-21856478 | 0.35 |
Q3ZCM7 | Tubulin beta-8 chain (Tubulin beta 8 class VIII) | EBI-21856478 | 0.35 |
Q13509 | Tubulin beta-3 chain (Tubulin beta-4 chain) (Tubulin beta-III) | EBI-21856478 | 0.35 |
P20930 | Filaggrin | EBI-21856478 | 0.35 |
P32233 | Developmentally-regulated GTP-binding protein 1 (DRG-1) (Neural precursor cell expressed developmentally down-regulated protein 3) (NEDD-3) (Translation factor GTPase DRG1) (TRAFAC GTPase DRG1) (EC 3.6.5.-) | EBI-15679531 | 0.64 |
Q9Y2A7 | Nck-associated protein 1 (NAP 1) (Membrane-associated protein HEM-2) (p125Nap1) | EBI-28931389 | 0.35 |
Q92896 | Golgi apparatus protein 1 (CFR-1) (Cysteine-rich fibroblast growth factor receptor) (E-selectin ligand 1) (ESL-1) (Golgi sialoglycoprotein MG-160) | EBI-28931389 | 0.35 |
Q14566 | DNA replication licensing factor MCM6 (EC 3.6.4.12) (p105MCM) | EBI-28931389 | 0.35 |
Q13405 | 39S ribosomal protein L49, mitochondrial (L49mt) (MRP-L49) (Mitochondrial large ribosomal subunit protein mL49) (Neighbor of FAU) (NOF) (Protein NOF1) | EBI-28931389 | 0.35 |
Q12888 | TP53-binding protein 1 (53BP1) (p53-binding protein 1) (p53BP1) | EBI-28931389 | 0.35 |
Q06418 | Tyrosine-protein kinase receptor TYRO3 (EC 2.7.10.1) (Tyrosine-protein kinase BYK) (Tyrosine-protein kinase DTK) (Tyrosine-protein kinase RSE) (Tyrosine-protein kinase SKY) (Tyrosine-protein kinase TIF) | EBI-28931389 | 0.35 |
P61081 | NEDD8-conjugating enzyme Ubc12 (EC 2.3.2.34) (NEDD8 carrier protein) (Ubiquitin-conjugating enzyme E2 M) | EBI-28931389 | 0.35 |
P41240 | Tyrosine-protein kinase CSK (EC 2.7.10.2) (C-Src kinase) (Protein-tyrosine kinase CYL) | EBI-28931389 | 0.35 |
P33993 | DNA replication licensing factor MCM7 (EC 3.6.4.12) (CDC47 homolog) (P1.1-MCM3) | EBI-28931389 | 0.35 |
P31350 | Ribonucleoside-diphosphate reductase subunit M2 (EC 1.17.4.1) (Ribonucleotide reductase small chain) (Ribonucleotide reductase small subunit) | EBI-28931389 | 0.35 |
P09497 | Clathrin light chain B (Lcb) | EBI-28931389 | 0.35 |
Database | Links |
UNIPROT | O75716 A8K9H9 Q5U0F8 Q96KI2 Q9BUH4 Q9UEN3 Q9UP78 |
PDB | 2BUJ |
Pfam | PF00069 |
PROSITE | PS50011 PS00108 |
OMIM | 604719 |
DisGeNET | 8576 |