Carbon catabolite-derepressing protein kinase - Saccharomyces cerevisiae S288C

Carbon catabolite-derepressing protein kinase (Saccharomyces cerevisiae S288C)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	Carbon catabolite-derepressing protein kinase
Accession Code	P06782
Gene	SNF1
Organism	Saccharomyces cerevisiae S288C (Taxonomy: 559292)
Part of Reference Proteome?	Yes
Sequence (Length: 633)
MSSNNNTNTAPANANSSHHHHHHHHHHHHHGHGGSNSTLNNPKSSLADGAHIGNYQIVKTLGEGSFGKVKLAYHTTTGQK VALKIINKKVLAKSDMQGRIEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYAGNELFDYIVQRDKMSEQEARRFFQQ IISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGV ILYVMLCRRLPFDDESIPVLFKNISNGVYTLPKFLSPGAAGLIKRMLIVNPLNRISIHEIMQDDWFKVDLPEYLLPPDLK PHPEEENENNDSKKDGSSPDNDEIDDNLVNILSSTMGYEKDEIYESLESSEDTPAFNEIRDAYMLIKENKSLIKDMKANK SVSDELDTFLSQSPPTFQQQSKSHQKSQVDHETAKQHARRMASAITQQRTYHQSPFMDQYKEEDSTVSILPTSLPQIHRA NMLAQGSPAASKISPLVTKKSKTRWHFGIRSRSYPLDVMGEIYIALKNLGAEWAKPSEEDLWTIKLRWKYDIGNKTNTNE KIPDLMKMVIQLFQIETNNYLVDFKFDGWESSYGDDTTVSNISEDEMSTFSAYPFLHLTTKLIMELAVNSQSN

Structure Viewer (PDB: 3TDH)

Subcellular Location

Description
Cytoplasm {Experimental EvidencePubMed:25869125}. Nucleus {Experimental EvidencePubMed:25869125}. Nucleus membrane {ECO:0000269\|PubMed:17237508}; Peripheral membrane protein {ECO:0000269\|PubMed:17237508}. Note=Nuclear translocation occurs under nitrogen and glucose starvation conditions (PubMed:25869125). {Experimental EvidencePubMed:25869125}.
Position in the Nuclear Envelope
Location	Location ID	Description
Nuclear Envelope	SL-0178	The nuclear envelope is a membrane system which surrounds the nucleoplasm of eukaryotic cells. It is composed of the nuclear lamina, nuclear pore complexes and two nuclear membranes. The space between the two membranes is called the nuclear intermembrane space.
Nuclear Membrane	SL-0182	The membrane surrounding the nucleus. This term is used when it is not known if the protein is found in or associated with the inner or outer nuclear membrane.
Membrane Topology
Topology	Source	Annotation Type
Peripheral	UniProt	Experimental Evidence {ECO:0000269\|PubMed:17237508}
Assigned Ontology terms

Cellular Component	Cellular Bud Neck Septin Ring (GO:0000144) Cytoplasm (GO:0005737) Mitochondrion (GO:0005739) Nuclear Envelope Lumen (GO:0005641) Nuclear Membrane (GO:0031965) Nucleotide-Activated Protein Kinase Complex (GO:0031588) Nucleus (GO:0005634) Vacuolar Membrane (GO:0005774)

Biology & Function

Description
Serine/threonine protein kinase essential for release from glucose repression (PubMed:3526554, PubMed:6366512, PubMed:3049551, PubMed:1944227, PubMed:8289797, PubMed:8628258, PubMed:25869125). Catalytic subunit of the AMP-activated protein kinase complex also known as the SNF1 kinase complex (Snf1c), a central regulator of cellular energy homeostasis, which, in response to a fall in intracellular ATP levels, activates energy-producing pathways and inhibits energy-consuming processes (PubMed:8289797, PubMed:26667037). The complex phosphorylates histone H3 to form H3S10ph, which promotes H3K14ac formation, leading to transcriptional activation through TBP recruitment to the promoters (PubMed:15719021). The complex also negatively regulates the HOG1 MAPK pathway in ER stress response including unfolded protein response (UPR) (PubMed:25730376, PubMed:26394309). Under nutrient/energy depletion, the complex phosphorylates and activates PAS kinase PSK1 which in turn activates PBS1, leading to the inhibition of the TORC1 signaling pathway (PubMed:25428989). SNF1 also interacts and phosphorylates adenylate cyclase CYR1 and negatively regulates the protein kinase A signaling pathway (PubMed:26309257). Also phosphorylates and regulates the transcriptional activator CAT8 (PubMed:15121831). {Experimental EvidencePubMed:15121831, Experimental EvidencePubMed:15719021, Experimental EvidencePubMed:1944227, Experimental EvidencePubMed:25428989, Experimental EvidencePubMed:25730376, Experimental EvidencePubMed:25869125, Experimental EvidencePubMed:26309257, Experimental EvidencePubMed:26394309, Experimental EvidencePubMed:26667037, Experimental EvidencePubMed:3049551, Experimental EvidencePubMed:3526554, Experimental EvidencePubMed:6366512, Experimental EvidencePubMed:8289797, Experimental EvidencePubMed:8628258}.
Assigned Ontology terms

Biological Process	Carbohydrate Metabolic Process (GO:0005975) Cell Adhesion (GO:0007155) Cellular Response To Nitrogen Starvation (GO:0006995) Establishment Of Mitotic Spindle Orientation (GO:0000132) Filamentous Growth (GO:0030447) Fungal-Type Cell Wall Assembly (GO:0071940) Intracellular Signal Transduction (GO:0035556) Invasive Growth In Response To Glucose Limitation (GO:0001403) Negative Regulation Of Translation (GO:0017148) Positive Regulation Of Filamentous Growth Of A Population Of Unicellular Organisms In Response To Starvation (GO:1900436) Positive Regulation Of Gluconeogenesis (GO:0045722) Positive Regulation Of Macroautophagy (GO:0016239) Positive Regulation Of Pseudohyphal Growth (GO:2000222) Protein Phosphorylation (GO:0006468) Regulation Of Cellular Response To Glucose Starvation (GO:1904547) Regulation Of Invasive Growth In Response To Glucose Limitation (GO:2000217) Response To Endoplasmic Reticulum Stress (GO:0034976) Response To Unfolded Protein (GO:0006986) Single-Species Surface Biofilm Formation (GO:0090606)
Molecular Function	AMP-Activated Protein Kinase Activity (GO:0004679) ATP Binding (GO:0005524) Guanyl-Nucleotide Exchange Factor Activity (GO:0005085) Identical Protein Binding (GO:0042802) Molecular Function Activator Activity (GO:0140677) Protein Kinase Activity (GO:0004672) Protein Serine Kinase Activity (GO:0106310) Protein Serine/Threonine Kinase Activity (GO:0004674)

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (3 interactors)

Partner (NucEnvDB)		IntAct	Confidence score
P30822	Exportin-1	EBI-11611503	0.35
P06782	Self	EBI-15573379	0.74
P25491	Mitochondrial protein import protein MAS5	EBI-3766560	0.35
Interactions with other proteins (71 interactors)

Partner (UniProt)		IntAct	Confidence score
Q04739	SNF1 protein kinase subunit beta-3 (Glucose repression protein GAL83) (Protein SPM1)	EBI-391371	0.86
P34164	SNF1 protein kinase subunit beta-2 (Protein SPM2) (SNF1-interacting protein 2)	EBI-391374	0.91
P40151	DNA-dependent ATPase MGS1 (Maintenance of genome stability protein 1)	EBI-391377	0.37
Q03957	CTD kinase subunit alpha (CTDK-I subunit alpha) (EC 2.7.11.23) (CTD kinase 58 kDa subunit) (CTD kinase subunit 1)	EBI-7822865	0.51
P12904	5'-AMP-activated protein kinase subunit gamma (AMPK gamma) (AMPK subunit gamma) (Regulatory protein CAT3) (Sucrose non-fermenting protein 4)	EBI-6956627	0.97
P11484	Ribosome-associated molecular chaperone SSB1 (EC 3.6.4.10) (Cold-inducible protein YG101) (Heat shock protein SSB1) (Hsp70 chaperone Ssb)	EBI-804120	0.53
P32578	SNF1 protein kinase subunit beta-1 (SNF1-interacting protein 1)	EBI-804120	0.67
Q00816	Resistance to glucose repression protein 1 (Protein HEX2) (Second-site suppressor of the rna1-1 mutation 1)	EBI-804120	0.72
P38990	SNF1-activating kinase 1 (EC 2.7.11.1)	EBI-804120	0.56
P22204	Cell cycle protein kinase DBF2 (EC 2.7.11.1) (Dumbbell forming protein 2)	EBI-821767	0.35
P32598	Serine/threonine-protein phosphatase PP1-2 (EC 3.1.3.16)	EBI-821800	0.35
P07270	Phosphate system positive regulatory protein PHO4	EBI-821981	0.35
P36047	Protein phosphatase 1 regulatory subunit SDS22	EBI-822217	0.35
P14693	Sorting assembly machinery 35 kDa subunit (Mitochondrial 38 kDa outer membrane protein) (TOB complex 38 kDa subunit)	EBI-855112	0.00
P0CG63	Polyubiquitin [Cleaved into: Ubiquitin]	EBI-7480635	0.44
Q04049	DNA polymerase eta (EC 2.7.7.7) (Radiation-sensitive protein 30)	EBI-7569766	0.40
P40433	6-phosphofructo-2-kinase 1 (6PF-2-K 1) (EC 2.7.1.105) (Phosphofructokinase 2 I)	EBI-7452404	0.35
Q84VQ1	SNF1-related protein kinase regulatory subunit beta-1 (AKIN subunit beta-1) (AKINB1) (AKINbeta1)	EBI-2042520	0.37
Q9SCY5	SNF1-related protein kinase regulatory subunit beta-2 (AKIN subunit beta-2) (AKINB2) (AKINbeta2)	EBI-2042539	0.37
Q42384	Protein pleiotropic regulatory locus 1 (Protein PRL1) (MOS4-associated complex protein 2) (MAC protein 2)	EBI-2107111	0.37
P32562	Cell cycle serine/threonine-protein kinase CDC5/MSD2 (EC 2.7.11.21)	EBI-2112894	0.35
Q08732	Serine/threonine-protein kinase HRK1 (EC 2.7.11.1) (Hygromycin resistance kinase 1)	EBI-2610513	0.35
P22211	Nitrogen permease reactivator protein (EC 2.7.11.1) (Serine/threonine-protein kinase NPR1)	EBI-2612723	0.50
P47035	Nucleolar protein NET1	EBI-2613798	0.35
Q00684	Tyrosine-protein phosphatase CDC14 (EC 3.1.3.48)	EBI-2613798	0.50
P80667	Peroxisomal membrane protein PAS20 (Peroxin-13)	EBI-7469935	0.37
P10591	Heat shock protein SSA1 (Heat shock protein YG100)	EBI-3677386	0.35
P32589	Heat shock protein homolog SSE1 (Chaperone protein MSI3)	EBI-3729858	0.35
P09435	Heat shock protein SSA3	EBI-3775934	0.35
P39987	Heat shock protein SSC3, mitochondrial (Extracellular mutant protein 10)	EBI-3788442	0.35
P02829	ATP-dependent molecular chaperone HSP82 (82 kDa heat shock protein) (Heat shock protein Hsp90 heat-inducible isoform)	EBI-3814316	0.35
P31539	Heat shock protein 104 (Protein aggregation-remodeling factor HSP104)	EBI-3827904	0.35
P11792	Serine/threonine-protein kinase SCH9 (EC 2.7.11.1)	EBI-4567519	0.44
P50222	Homeobox protein MOX-2 (Growth arrest-specific homeobox) (Mesenchyme homeobox 2)	EBI-11522962	0.56
Q9UKT9	Zinc finger protein Aiolos (Ikaros family zinc finger protein 3)	EBI-11523031	0.56
Q9BQ66	Keratin-associated protein 4-12 (Keratin-associated protein 4.12) (Ultrahigh sulfur keratin-associated protein 4.12)	EBI-11523022	0.56
Q99750	MyoD family inhibitor (Myogenic repressor I-mf)	EBI-11523013	0.56
Q8N5R6	Coiled-coil domain-containing protein 33 (Cancer/testis antigen 61) (CT61)	EBI-11522974	0.56
P14373	Zinc finger protein RFP (EC 2.3.2.27) (RING finger protein 76) (RING-type E3 ubiquitin transferase TRIM27) (Ret finger protein) (Tripartite motif-containing protein 27)	EBI-11522995	0.56
O43597	Protein sprouty homolog 2 (Spry-2)	EBI-11522986	0.56
P54619	5'-AMP-activated protein kinase subunit gamma-1 (AMPK gamma1) (AMPK subunit gamma-1) (AMPKg)	EBI-11523004	0.56
Q06213	Mediator of RNA polymerase II transcription subunit 10 (Mediator complex subunit 10) (Negative regulator of URS2 protein 2)	EBI-15978232	0.37
P38782	Mediator of RNA polymerase II transcription subunit 6 (Mediator complex subunit 6)	EBI-15978215	0.37
P32570	Mediator of RNA polymerase II transcription subunit 22 (Mediator complex subunit 22) (Suppressor of RNA polymerase B 6)	EBI-15978331	0.37
P47821	RNA polymerase II holoenzyme cyclin-like subunit (Suppressor of RNA polymerase B 11)	EBI-15978390	0.37
Q00776	AP-1 complex subunit mu-1-I (Clathrin assembly protein complex 1 mu-1-I medium chain) (Clathrin coat assembly protein AP54) (Clathrin coat-associated protein AP54) (Golgi adaptor AP-1 54 kDa protein) (HA1 54 kDa subunit) (Mu(1)-adaptin) (Mu1-I-adaptin)	EBI-16263794	0.35
Q99186	AP-2 complex subunit mu (Adaptin medium chain APM4) (Clathrin assembly protein complex 2 mu medium chain) (Clathrin coat assembly protein AP50) (Clathrin coat-associated protein AP50) (Mu2-adaptin) (Plasma membrane adaptor AP-2 50 kDa protein)	EBI-16263964	0.35
P07260	Eukaryotic translation initiation factor 4E (eIF-4E) (eIF4E) (eIF-4F 25 kDa subunit) (mRNA cap-binding protein)	EBI-16265957	0.35
P24719	Meiosis-specific serine/threonine-protein kinase MEK1 (EC 2.7.11.1)	EBI-16273423	0.35
P38622	Serine/threonine-protein kinase RCK1 (EC 2.7.11.1)	EBI-16279033	0.35
Q04279	Eisosome protein SEG1 (Stability of eisosomes guaranteed protein 1)	EBI-16283487	0.35
P07259	Protein URA2 [Includes: Glutamine-dependent carbamoyl-phosphate synthase (EC 6.3.5.5); Aspartate carbamoyltransferase (EC 2.1.3.2)]	EBI-16283487	0.35
P04838	Polyubiquitin [Cleaved into: Ubiquitin-related; Ubiquitin]	EBI-16283487	0.35
P02557	Tubulin beta chain (Beta-tubulin)	EBI-16283487	0.35
P09733	Tubulin alpha-1 chain (EC 3.6.5.-)	EBI-16283487	0.35
P02994	Elongation factor 1-alpha (EF-1-alpha) (Eukaryotic elongation factor 1A) (eEF1A) (Translation elongation factor 1A)	EBI-16283487	0.35
P25567	RNA-binding protein SRO9 (Suppressor of RHO3 protein 9)	EBI-16283487	0.35
P11075	Protein transport protein SEC7	EBI-16283487	0.35
P10659	S-adenosylmethionine synthase 1 (AdoMet synthase 1) (EC 2.5.1.6) (Methionine adenosyltransferase 1) (MAT 1)	EBI-16283487	0.35
P09232	Cerevisin (EC 3.4.21.48) (Proteinase YSCB) (Vacuolar protease B) (PrB)	EBI-16283487	0.35
P04806	Hexokinase-1 (EC 2.7.1.1) (Hexokinase PI) (Hexokinase-A)	EBI-16283487	0.35
Q04233	Protein GIS4	EBI-16283487	0.35
P04385	Galactokinase (EC 2.7.1.6) (Galactose kinase)	EBI-16283487	0.35
P07149	Fatty acid synthase subunit beta (EC 2.3.1.86) [Includes: 3-hydroxyacyl-[acyl-carrier-protein] dehydratase (EC 4.2.1.59); Enoyl-[acyl-carrier-protein] reductase [NADH] (EC 1.3.1.9); [Acyl-carrier-protein] acetyltransferase (EC 2.3.1.38); [Acyl-carrier-protein] malonyltransferase (EC 2.3.1.39); S-acyl fatty acid synthase thioesterase (EC 3.1.2.14)]	EBI-16283487	0.35
P25694	Cell division control protein 48 (EC 3.6.4.6) (Cell division cycle protein 48) (Transitional endoplasmic reticulum ATPase homolog)	EBI-16283487	0.35
P29311	Protein BMH1	EBI-16283487	0.35
P11076	ADP-ribosylation factor 1 (EC 3.6.5.2)	EBI-16283487	0.35
P38915	Transcription factor SPT8	EBI-16284064	0.40
Q03897	Maintenance of telomere capping protein 5 (SEH-associated protein 3)	EBI-16287729	0.35
P18961	Serine/threonine-protein kinase YPK2/YKR2 (EC 2.7.11.1)	EBI-16292335	0.35
P38232	Protein REG2	EBI-16397973	0.51

Cross-References

Database	Links
UNIPROT	P06782 D6VTA0
PDB	2FH9 2QLV 3DAE 3HYH 3MN3 3T4N 3TDH 3TE5
Pfam	PF16579 PF00069 PF08587
PROSITE	PS00107 PS50011 PS00108

Carbon catabolite-derepressing protein kinase (Saccharomyces cerevisiae S288C)

General Information

Protein Information

Structure Viewer (PDB: 3TDH)

Subcellular Location

Description Show

Position in the Nuclear Envelope

Membrane Topology

Assigned Ontology terms

Biology & Function

Description Hide

Assigned Ontology terms

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (3 interactors)

Interactions with other proteins (71 interactors)

Cross-References

Database

Links

Description

Description