Mitochondrial protein import protein MAS5 - Saccharomyces cerevisiae S288C

Mitochondrial protein import protein MAS5 (Saccharomyces cerevisiae S288C)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	Mitochondrial protein import protein MAS5
Accession Code	P25491
Gene	YDJ1
Organism	Saccharomyces cerevisiae S288C (Taxonomy: 559292)
Part of Reference Proteome?	Yes
Sequence (Length: 409)
MVKETKFYDILGVPVTATDVEIKKAYRKCALKYHPDKNPSEEAAEKFKEASAAYEILSDPEKRDIYDQFGEDGLSGAGGA GGFPGGGFGFGDDIFSQFFGAGGAQRPRGPQRGKDIKHEISASLEELYKGRTAKLALNKQILCKECEGRGGKKGAVKKCT SCNGQGIKFVTRQMGPMIQRFQTECDVCHGTGDIIDPKDRCKSCNGKKVENERKILEVHVEPGMKDGQRIVFKGEADQAP DVIPGDVVFIVSERPHKSFKRDGDDLVYEAEIDLLTAIAGGEFALEHVSGDWLKVGIVPGEVIAPGMRKVIEGKGMPIPK YGGYGNLIIKFTIKFPENHFTSEENLKKLEEILPPRIVPAIPKKATVDECVLADFDPAKYNRTRASRGGANYDSDEEEQG GEGVQCASQ

Structure Viewer (PDB: 1XAO)

Subcellular Location

Description
Cytoplasm. Cytoplasm, perinuclear region. Note=Concentrated in a perinuclear ring as well as in the cytoplasm.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Lipid-Anchored	UniProt	Experimental Evidence {ECO:0000269\|PubMed:1527016}
Assigned Ontology terms

Cellular Component	Cytoplasm (GO:0005737) Cytosol (GO:0005829) Nucleus (GO:0005634) Perinuclear Region Of Cytoplasm (GO:0048471) Transcription Repressor Complex (GO:0017053) TRC Complex (GO:0072380)

Biology & Function

Description
Probably involved in mitochondrial protein import. Is also required for efficient translocation of pre-pro-alpha-factor. Involved in heme regulation of HAP1, as a component of the high-molecular-weight (HMC) complex. {Experimental EvidencePubMed:11689685}.
Assigned Ontology terms

Biological Process	'De Novo' Protein Folding (GO:0006458) Chaperone-Mediated Protein Complex Assembly (GO:0051131) Negative Regulation Of DNA-Templated Transcription (GO:0045892) Protein Refolding (GO:0042026) Protein Targeting To ER (GO:0045047) Protein Targeting To Mitochondrion (GO:0006626) Response To Heat (GO:0009408) Response To Oxygen Levels (GO:0070482) TRNA Import Into Nucleus (GO:0035719) Ubiquitin-Dependent ERAD Pathway (GO:0030433) Ubiquitin-Dependent Protein Catabolic Process (GO:0006511)
Molecular Function	ATP Binding (GO:0005524) ATPase Activator Activity (GO:0001671) Chaperone Binding (GO:0051087) Hsp70 Protein Binding (GO:0030544) Metal Ion Binding (GO:0046872) Unfolded Protein Binding (GO:0051082)

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (20 interactors)

Partner (NucEnvDB)		IntAct	Confidence score
P06105	Protein SCP160	EBI-3664276	0.35
P06782	Carbon catabolite-derepressing protein kinase	EBI-3766560	0.35
P25491	Self	EBI-6319619	0.00
P30822	Exportin-1	EBI-3663255	0.35
P39705	Nucleoporin NUP60	EBI-3663903	0.35
Q04175	Importin beta SMX1	EBI-3664452	0.35
Q02455	Protein MLP1	EBI-3765167	0.35
P40457	Protein MLP2	EBI-3765175	0.35
P53159	Monopolar spindle protein 2	EBI-3765215	0.35
P40064	Nucleoporin NUP157	EBI-3765456	0.35
P38181	Nucleoporin NUP170	EBI-3765464	0.35
P46674	Nuclear mRNA export protein SAC3	EBI-3766328	0.35
Q03707	Inner nuclear membrane protein SRC1	EBI-3766672	0.35
P40075	Vesicle-associated membrane protein-associated protein SCS2	EBI-9975925	0.35
P53541	Putative meiotic phospholipase SPO1	EBI-16283760	0.35
P53983	Probable ERAD-associated E3 ubiquitin-protein ligase ASI1	EBI-3763707	0.35
Q06151	m7GpppX diphosphatase	EBI-3764256	0.35
P38217	Importin subunit beta-2	EBI-3663671	0.35
P32767	Importin beta-like protein KAP122	EBI-3764975	0.35
Q04431	Spindle pole body component KRE28	EBI-3664804	0.35
Interactions with other proteins (881 interactors)

Partner (UniProt)		IntAct	Confidence score
P38085	Valine/tyrosine/tryptophan amino-acid permease 1 (Tyrosine and tryptophan amino acid transporter 1)	EBI-785720	0.35
P21147	Acyl-CoA desaturase 1 (EC 1.14.19.1) (Delta 9 fatty acid desaturase) (Fatty acid desaturase 1) (Stearoyl-CoA desaturase 1)	EBI-786767	0.35
P06839	General transcription and DNA repair factor IIH helicase subunit XPD (TFIIH subunit XPD) (EC 3.6.4.12) (DNA repair helicase RAD3) (RNA polymerase II transcription factor B subunit RAD3) (TFB subunit RAD3)	EBI-791932	0.64
P00830	ATP synthase subunit beta, mitochondrial (EC 7.1.2.2)	EBI-813344	0.27
P38737	Proteasome component ECM29 (Extracellular mutant protein 29)	EBI-814203	0.51
P33892	eIF-2-alpha kinase activator GCN1 (General control non-derepressible protein 1) (Translational activator GCN1)	EBI-819274	0.51
P18239	ADP,ATP carrier protein 2 (ADP/ATP translocase 2) (Adenine nucleotide translocator 2) (ANT 2) (Petite colonies protein 9)	EBI-820078	0.27
P36046	Mitochondrial intermembrane space import and assembly protein 40 (Mitochondrial import inner membrane translocase TIM40)	EBI-853933	0.53
P0CG63	Polyubiquitin [Cleaved into: Ubiquitin]	EBI-7479876	0.44
P02829	ATP-dependent molecular chaperone HSP82 (82 kDa heat shock protein) (Heat shock protein Hsp90 heat-inducible isoform)	EBI-863329	0.62
P12866	Alpha-factor-transporting ATPase (EC 7.4.2.7) (Mating factor A secretion protein STE6) (Multiple drug resistance protein homolog) (P-glycoprotein)	EBI-1637343	0.35
Q12118	Small glutamine-rich tetratricopeptide repeat-containing protein 2 (SGT/UBP) (Viral protein U-binding protein)	EBI-1782119	0.64
Q12285	Ubiquitin-like protein MDY2 (Golgi to ER traffic protein 5) (Mating-deficient protein 2) (Translation machinery-associated protein 24)	EBI-1782144	0.52
Q7LKB1	Eukaryotic peptide chain release factor GTP-binding subunit (ERF-3) (ERF2) (Polypeptide release factor 3) (Translation release factor 3)	EBI-8411464	0.54
P39743	Reduced viability upon starvation protein 167	EBI-7317561	0.31
Q08273	RING-box protein HRT1 (RING-box protein 1) (E3 ubiquitin-protein ligase complex SCF subunit HRT1) (High level expression reduces Ty3 transposition protein 1) (Regulator of cullins protein 1)	EBI-2794894	0.53
P25567	RNA-binding protein SRO9 (Suppressor of RHO3 protein 9)	EBI-2904800	0.35
P0CS82	Heme-responsive zinc finger transcription factor HAP1 (CYP1 activatory protein) (Heme activator protein 1)	EBI-2904800	0.35
P39101	Protein CAJ1	EBI-3654696	0.35
P46997	J protein JJJ2	EBI-3658264	0.35
P25294	Protein SIS1	EBI-3663071	0.35
P38009	Bifunctional purine biosynthesis protein ADE17 [Includes: Phosphoribosylaminoimidazolecarboxamide formyltransferase (EC 2.1.2.3) (5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase) (AICAR transformylase); IMP cyclohydrolase (EC 3.5.4.10) (ATIC) (IMP synthase) (Inosinicase)]	EBI-3663079	0.35
P07244	Bifunctional purine biosynthetic protein ADE5,7 [Includes: Phosphoribosylamine--glycine ligase (EC 6.3.4.13) (Glycinamide ribonucleotide synthetase) (GAR synthetase) (GARS) (Phosphoribosylglycinamide synthetase); Phosphoribosylformylglycinamidine cyclo-ligase (EC 6.3.3.1) (AIR synthase) (AIR synthetase) (AIRS) (Phosphoribosyl-aminoimidazole synthetase)]	EBI-3663087	0.35
P38972	Phosphoribosylformylglycinamidine synthase (FGAM synthase) (FGAMS) (EC 6.3.5.3) (Formylglycinamide ribonucleotide amidotransferase) (FGAR amidotransferase) (FGAR-AT) (Formylglycinamide ribotide amidotransferase)	EBI-3663095	0.35
P25376	General amino acid permease AGP1 (Asparagine/glutamine permease)	EBI-3663103	0.35
P47019	Ribosome biogenesis protein ALB1	EBI-3663111	0.35
P47771	Aldehyde dehydrogenase [NAD(P)+] 1 (EC 1.2.1.3)	EBI-3663119	0.35
P54115	Magnesium-activated aldehyde dehydrogenase, cytosolic (EC 1.2.1.-) (EC 1.2.1.4) (Mg(2+)-activated acetaldehyde dehydrogenase) (Mg(2+)-ACDH)	EBI-3663127	0.35
P46682	AP-3 complex subunit beta (Adaptor-related protein complex 3 subunit beta) (Beta-3-adaptin) (Clathrin assembly protein complex 3 beta large chain) (Clathrin assembly protein large beta chain)	EBI-3663135	0.35
P38328	Actin-related protein 2/3 complex subunit 1 (Arp2/3 complex 41 kDa subunit) (p41-ARC)	EBI-3663143	0.35
Q12500	Late secretory pathway protein AVL9 (APL2 VPS1 synthetic lethal protein 9)	EBI-3663151	0.35
Q05029	Protein BCH1 (BUD7 and CHS6 homolog 1)	EBI-3663159	0.35
P34730	Protein BMH2	EBI-3663167	0.35
P47039	Probable kynurenine--oxoglutarate transaminase BNA3 (EC 2.6.1.7) (Biosynthesis of nicotinic acid protein 3) (Kynurenine aminotransferase)	EBI-3663175	0.35
Q07457	E3 ubiquitin-protein ligase BRE1 (EC 2.3.2.27) (Brefeldin A-sensitivity protein 1) (RING-type E3 ubiquitin transferase BRE1)	EBI-3663183	0.35
P32639	Pre-mRNA-splicing helicase BRR2 (EC 3.6.4.13) (Protein Snu246)	EBI-3663191	0.35
P40096	Negative cofactor 2 complex subunit alpha (NC2 complex subunit alpha) (Transcription repressor BUR6)	EBI-3663199	0.35
P00812	Arginase (EC 3.5.3.1)	EBI-3663207	0.35
P33322	H/ACA ribonucleoprotein complex subunit CBF5 (EC 5.4.99.-) (Centromere-binding factor 5) (Centromere/microtubule-binding protein CBF5) (H/ACA snoRNP protein CBF5) (Small nucleolar RNP protein CBF5) (p64')	EBI-3663215	0.35
P31384	CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4 (EC 3.1.13.4) (Carbon catabolite repressor protein 4) (Cytoplasmic deadenylase) (Glucose-repressible alcohol dehydrogenase transcriptional effector)	EBI-3663223	0.53
Q03705	EKC/KEOPS complex subunit CGI121 (CGI-121 homolog)	EBI-3663231	0.35
P19454	Casein kinase II subunit alpha' (CK II) (EC 2.7.11.1)	EBI-3663239	0.35
P53195	Conserved oligomeric Golgi complex subunit 7 (COG complex subunit 7) (Complexed with DOR1 protein 5) (Component of oligomeric Golgi complex 7)	EBI-3663247	0.35
Q06440	Coronin-like protein	EBI-3663263	0.35
P14922	General transcriptional corepressor CYC8 (Glucose repression mediator protein CYC8)	EBI-3663271	0.35
P36009	Probable ATP-dependent RNA helicase DHR2 (EC 3.6.4.13) (DEAH box RNA helicase DHR2) (Helicase JA2)	EBI-3663279	0.53
Q04216	Defect at low temperature protein 1	EBI-3663287	0.35
P54858	Protein DOS2	EBI-3663295	0.35
P32461	2-(3-amino-3-carboxypropyl)histidine synthase subunit 2 (Diphthamide biosynthesis protein 2) (Diphtheria toxin resistance protein 2) (S-adenosyl-L-methionine:L-histidine 3-amino-3-carboxypropyltransferase 2)	EBI-3663303	0.35
P53911	Chromatin modification-related protein EAF7 (ESA1-associated factor 7)	EBI-3663311	0.35
P47169	Sulfite reductase [NADPH] subunit beta (EC 1.8.1.2) (Extracellular mutant protein 17)	EBI-3663319	0.35
P38241	Pre-mRNA-splicing factor SLT11 (Extracellular mutant protein 2) (Synthetic lethality with U2 protein 11)	EBI-3663327	0.35
P32324	Elongation factor 2 (EF-2) (Eukaryotic elongation factor 2) (eEF2) (Ribosomal translocase) (Translation elongation factor 2)	EBI-3663335	0.35
Q04409	Putative glucokinase-2 (EC 2.7.1.2) (Early meiotic induction protein 2) (Glucose kinase 2) (GLK-2)	EBI-3663343	0.35
P00924	Enolase 1 (EC 4.2.1.11) (2-phospho-D-glycerate hydro-lyase 1) (2-phosphoglycerate dehydratase 1)	EBI-3663351	0.35
P38333	Essential nuclear protein 1	EBI-3663359	0.35
P43572	Enhancer of polycomb-like protein 1	EBI-3663367	0.35
P32353	Delta(7)-sterol 5(6)-desaturase ERG3 (EC 1.14.19.20) (C-5 sterol desaturase ERG3) (Ergosterol Delta(5,6) desaturase ERG3) (Ergosterol biosynthetic protein 3) (Sterol-C5-desaturase)	EBI-3663375	0.35
P39704	Protein ERP2	EBI-3663383	0.35
P38819	Protein ERP5	EBI-3663391	0.35
Q08649	Histone acetyltransferase ESA1 (EC 2.3.1.48) (Protein 2-hydroxyisobutyryltransferase ESA1) (EC 2.3.1.-) (Protein acetyltransferase ESA1) (EC 2.3.1.-) (Protein crotonyltransferase ESA1) (EC 2.3.1.-)	EBI-3663399	0.35
P53743	Pre-rRNA-processing protein ESF2 (18S rRNA factor 2)	EBI-3663407	0.35
Q12178	Cytosine deaminase (yCD) (EC 3.5.4.1) (Cytosine aminohydrolase) (Fluorocytosine resistance protein 1)	EBI-3663415	0.35
P39730	Eukaryotic translation initiation factor 5B (eIF-5B) (EC 3.6.5.3) (Translation initiation factor IF-2)	EBI-3663423	0.35
Q08193	1,3-beta-glucanosyltransferase GAS5 (EC 2.4.1.-) (Glycolipid-anchored surface protein 5)	EBI-3663431	0.35
P41814	tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6 (General control non-derepressible protein 10) (Protein GCD10) (tRNA(m1A58)-methyltransferase subunit TRM6) (tRNA(m1A58)MTase subunit TRM6)	EBI-3663439	0.35
P12754	Translation initiation factor eIF-2B subunit delta (GCD complex subunit GCD2) (Guanine nucleotide exchange factor subunit GCD2) (eIF-2B GDP-GTP exchange factor subunit delta)	EBI-3663447	0.35
P43535	Protein GCN20 (General control non-derepressible protein 20)	EBI-3663455	0.35
Q05584	Hydroxyacylglutathione hydrolase, cytoplasmic isozyme (EC 3.1.2.6) (Glyoxalase II) (Glx II)	EBI-3663463	0.35
Q08220	Glutathione synthetase GSH2 (GSH synthetase) (GSH-S) (EC 6.3.2.3) (Glutathione synthase)	EBI-3663471	0.35
P27472	Glycogen [starch] synthase isoform 2 (EC 2.4.1.11)	EBI-3663479	0.35
P32190	Glycerol kinase (GK) (Glycerokinase) (EC 2.7.1.30) (ATP:glycerol 3-phosphotransferase)	EBI-3663487	0.35
Q12180	Halotolerance protein 9	EBI-3663495	0.35
Q12341	Histone acetyltransferase type B catalytic subunit (EC 2.3.1.48)	EBI-3663503	0.35
P20448	ATP-dependent RNA helicase HCA4 (EC 3.6.4.13) (DEAD box protein 4) (Helicase CA4) (Helicase UF1)	EBI-3663511	0.35
P11353	Oxygen-dependent coproporphyrinogen-III oxidase (COX) (Coprogen oxidase) (Coproporphyrinogenase) (EC 1.3.3.3)	EBI-3663519	0.35
Q04458	Fatty aldehyde dehydrogenase HFD1 (EC 1.2.1.3) (EC 1.2.1.64) (Hexadecenal dehydrogenase)	EBI-3663527	0.35
P61830	Histone H3	EBI-3663535	0.35
P47171	Histone transcription regulator 3	EBI-3663543	0.35
Q03973	High mobility group protein 1 (High spontaneous mutagenesis protein 2)	EBI-3663551	0.35
P32478	Cell wall mannoprotein HSP150 (150 kDa heat shock glycoprotein) (Covalently-linked cell wall protein 7) (Protein with internal repeats 2)	EBI-3663559	0.35
P04912	Histone H2A.2	EBI-3663567	0.35
P07263	Histidine--tRNA ligase, mitochondrial (EC 6.1.1.21) (Histidyl-tRNA synthetase) (HisRS)	EBI-3663575	0.35
Q12692	Histone H2A.Z	EBI-3663583	0.35
P04807	Hexokinase-2 (EC 2.7.1.1) (Hexokinase PII) (Hexokinase-B)	EBI-3663591	0.35
P43579	Ino eighty subunit 1	EBI-3663599	0.35
P38286	Very-long-chain 3-oxoacyl-CoA reductase (EC 1.1.1.330) (3-ketoacyl-CoA reductase) (3-ketoreductase) (KAR) (Microsomal beta-keto-reductase)	EBI-3663607	0.35
P09436	Isoleucine--tRNA ligase, cytoplasmic (EC 6.1.1.5) (Isoleucyl-tRNA synthetase) (IleRS)	EBI-3663615	0.35
P00927	Threonine dehydratase, mitochondrial (EC 4.3.1.19) (Threonine deaminase)	EBI-3663623	0.35
P50095	Inosine-5'-monophosphate dehydrogenase 3 (IMP dehydrogenase 3) (IMPD 3) (IMPDH 3) (EC 1.1.1.205)	EBI-3663631	0.35
P53115	Chromatin-remodeling ATPase INO80 (EC 3.6.4.-) (Inositol-requiring protein 80)	EBI-3663639	0.35
P40006	Increased recombination centers protein 22	EBI-3663647	0.35
Q07821	Iron-sulfur assembly protein 1	EBI-3663655	0.35
P36132	tRNA N6-adenosine threonylcarbamoyltransferase (EC 2.3.1.234) (Kinase-associated endopeptidase 1) (N6-L-threonylcarbamoyladenine synthase) (t(6)A synthase) (t(6)A37 threonylcarbamoyladenosine biosynthesis protein KAE1) (tRNA threonylcarbamoyladenosine biosynthesis protein KAE1)	EBI-3663663	0.35
Q08979	Kelch repeat-containing protein 3	EBI-3663679	0.35
P22209	Serine/threonine-protein kinase KIN3 (EC 2.7.11.1)	EBI-3663687	0.35
P40540	ER membrane protein complex subunit 5 (Killer toxin-resistance protein 27)	EBI-3663695	0.35
Q3E840	Diphthamide biosynthesis protein 3 (Kluyveromyces lactis toxin-insensitive protein 11)	EBI-3663703	0.35
P12695	Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial (EC 2.3.1.12) (Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex) (Pyruvate dehydrogenase complex component E2) (PDC-E2) (PDCE2)	EBI-3663711	0.35
P57743	U6 snRNA-associated Sm-like protein LSm3 (SmX4 protein)	EBI-3663719	0.35
P53905	U6 snRNA-associated Sm-like protein LSm7	EBI-3663727	0.35
P48570	Homocitrate synthase, cytosolic isozyme (HCS) (EC 2.3.3.14)	EBI-3663735	0.35
P49367	Homoaconitase, mitochondrial (EC 4.2.1.36) (Homoaconitate hydratase)	EBI-3663743	0.35
P11914	Mitochondrial-processing peptidase subunit alpha (Alpha-MPP) (Inactive zinc metalloprotease alpha) (Matrix processing peptidase) (MPP) (Mitochondrial assembly protein 2) (Mitochondrial import function protein 2)	EBI-3663751	0.35
P39677	Ribosome-releasing factor 2, mitochondrial (RRF2mt) (Elongation factor G 2, mitochondrial) (EF-G2mt) (mEF-G 2)	EBI-3663759	0.35
P24719	Meiosis-specific serine/threonine-protein kinase MEK1 (EC 2.7.11.1)	EBI-3663767	0.35
P00958	Methionine--tRNA ligase, cytoplasmic (EC 6.1.1.10) (Methionyl-tRNA synthetase) (MetRS)	EBI-3663775	0.35
P53128	Methylenetetrahydrofolate reductase 2 (EC 1.5.1.20) (YmL45)	EBI-3663783	0.35
P33441	THO complex subunit MFT1 (Mitochondrial fusion target protein 1)	EBI-3663791	0.35
P09440	C-1-tetrahydrofolate synthase, mitochondrial (C1-THF synthase) [Includes: Methylenetetrahydrofolate dehydrogenase (EC 1.5.1.5); Methenyltetrahydrofolate cyclohydrolase (EC 3.5.4.9); Formyltetrahydrofolate synthetase (EC 6.3.4.3)]	EBI-3663799	0.35
P53141	Myosin light chain 1 (Calmodulin-like myosin light chain MLC1) (Myosin-2 light chain)	EBI-3663807	0.35
P25847	DNA mismatch repair protein MSH2 (MutS protein homolog 2)	EBI-3663815	0.35
P32335	Protein MSS51, mitochondrial (Mitochondrial splicing suppressor protein 51)	EBI-3663823	0.35
P47047	ATP-dependent RNA helicase DOB1 (EC 3.6.4.13) (mRNA transport regulator MTR4)	EBI-3663831	0.35
P19524	Myosin-2 (Cell division control protein 66) (Class V unconventional myosin MYO2) (Type V myosin heavy chain MYO2) (Myosin V MYO2)	EBI-3663839	0.35
P38205	Multisite-specific tRNA:(cytosine-C(5))-methyltransferase (EC 2.1.1.202) (Multisite-specific tRNA:m5C-methyltransferase) (tRNA (cytosine-5-)-methyltransferase NCL1) (tRNA methyltransferase 4)	EBI-3663847	0.35
Q08972	[NU+] prion formation protein 1	EBI-3663855	0.35
P53081	NGG1-interacting factor 3	EBI-3663863	0.35
P06102	General negative regulator of transcription subunit 3	EBI-3663871	0.35
P53164	NAD-capped RNA hydrolase NPY1 (DeNADding enzyme NPY1) (EC 3.6.1.-) (NADH pyrophosphatase) (EC 3.6.1.22)	EBI-3663879	0.35
P31378	Endonuclease III homolog 1 (EC 3.2.2.-) (EC 4.2.99.18) (Bifunctional DNA N-glycosylase/DNA-(apurinic or apyrimidinic site) lyase 1) (DNA glycosylase/AP lyase 1) (Endonuclease III-like glycosylase 1) (Redoxyendonuclease 1)	EBI-3663887	0.35
P35172	Probable trehalase (EC 3.2.1.28) (Alpha,alpha-trehalase) (Alpha,alpha-trehalose glucohydrolase)	EBI-3663895	0.35
P54784	Origin recognition complex subunit 1 (Origin recognition complex 120 kDa subunit)	EBI-3663911	0.35
P50874	Origin recognition complex subunit 5 (Origin recognition complex 53 kDa subunit)	EBI-3663919	0.35
P38826	Origin recognition complex subunit 6 (ACS-associated protein 1) (Origin recognition complex 50 kDa subunit)	EBI-3663927	0.35
Q12451	Oxysterol-binding protein homolog 2 (Oxysterol-binding protein-related protein 2) (ORP 2) (OSBP-related protein 2)	EBI-3663935	0.35
Q12447	Polyamine N-acetyltransferase 1 (EC 2.3.1.-) (Arylalkylamine N-acetyltransferase homolog) (scAANAT)	EBI-3663943	0.35
P38254	Probable tubulin--tyrosine ligase PBY1 (EC 6.3.2.25) (P-body-associated protein 1)	EBI-3663951	0.35
Q04264	Sister chromatid cohesion protein PDS5 (Precocious dissociation of sisters protein 5)	EBI-3663959	0.35
P42841	Polyadenylation factor subunit 2	EBI-3663967	0.53
P47110	DNA polymerase delta subunit 3	EBI-3663975	0.35
P39985	rDNA transcriptional regulator POL5 (EC 2.7.7.7) (DNA polymerase V) (POL V) (DNA polymerase phi)	EBI-3663983	0.35
P23595	Serine/threonine-protein phosphatase PP2A-2 catalytic subunit (EC 3.1.3.16)	EBI-3663991	0.53
P32345	Serine/threonine-protein phosphatase 4 catalytic subunit (PP4C) (EC 3.1.3.16) (Phosphatase PP2A-like catalytic subunit PPH3)	EBI-3663999	0.35
P53131	Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP43 (EC 3.6.4.13) (Helicase JA1)	EBI-3664007	0.35
P28708	Serine/threonine-protein kinase PRR1 (EC 2.7.11.1) (Pheromone response regulator 1)	EBI-3664015	0.35
Q12265	Ribose-phosphate pyrophosphokinase 5 (EC 2.7.6.1) (Phosphoribosyl pyrophosphate synthase 5)	EBI-3664023	0.35
P41940	Mannose-1-phosphate guanyltransferase (EC 2.7.7.13) (ATP-mannose-1-phosphate guanylyltransferase) (GDP-mannose pyrophosphorylase) (NDP-hexose pyrophosphorylase)	EBI-3664031	0.35
Q12335	Protoplast secreted protein 2	EBI-3664039	0.35
Q12318	Platinum sensitivity protein 3	EBI-3664047	0.35
P09368	Proline dehydrogenase, mitochondrial (EC 1.5.5.2) (Proline oxidase)	EBI-3664055	0.35
P06777	DNA repair protein RAD1	EBI-3664063	0.35
P32628	UV excision repair protein RAD23	EBI-3664071	0.35
P32641	Checkpoint protein RAD24	EBI-3664079	0.53
Q04231	DNA repair protein RAD33	EBI-3664095	0.35
P25454	DNA repair protein RAD51	EBI-3664103	0.35
P21538	DNA-binding protein REB1 (QBP)	EBI-3664111	0.35
P22336	Replication factor A protein 1 (RF-A protein 1) (DNA-binding protein BUF2) (Replication protein A 69 kDa DNA-binding subunit) (Single-stranded DNA-binding protein)	EBI-3664119	0.35
P39083	Rho-type GTPase-activating protein 1	EBI-3664127	0.35
Q00453	Probable transcription repressor protein RGM1	EBI-3664135	0.35
P16664	Guanine nucleotide exchange factor subunit RGP1 (Reduced growth phenotype protein 1) (Rgp1p)	EBI-3664143	0.35
P48565	pH-response regulator protein palH/RIM21 (Regulator of IME2 protein 21)	EBI-3664156	0.35
Q07844	Ribosome biogenesis ATPase RIX7	EBI-3664164	0.35
P21524	Ribonucleoside-diphosphate reductase large chain 1 (EC 1.17.4.1) (Ribonucleotide reductase R1 subunit 1) (Ribonucleotide reductase large subunit 1)	EBI-3664172	0.35
P32561	Histone deacetylase RPD3 (EC 3.5.1.98) (Transcriptional regulatory protein RPD3)	EBI-3664180	0.35
P17079	60S ribosomal protein L12-A (L15) (Large ribosomal subunit protein uL11-A) (YL23)	EBI-3664188	0.35
P53030	60S ribosomal protein L1-A (L10a) (Large ribosomal subunit protein uL1-A)	EBI-3664196	0.35
P32565	26S proteasome regulatory subunit RPN2	EBI-3664204	0.35
P40016	26S proteasome regulatory subunit RPN3	EBI-3664212	0.35
P40327	26S proteasome regulatory subunit 4 homolog (Tat-binding homolog 5)	EBI-3664220	0.35
Q12754	Ribosomal RNA-processing protein 12	EBI-3664228	0.35
P53236	Chromatin structure-remodeling complex subunit RSC1 (RSC complex subunit RSC1) (Remodel the structure of chromatin complex subunit 1)	EBI-3664236	0.35
Q05543	Regulator of Ty1 transposition protein 103	EBI-3664244	0.35
Q03940	RuvB-like protein 1 (RUVBL1) (EC 3.6.4.12) (TIP49-homology protein 1) (TIP49a homolog)	EBI-3664252	0.35
P32368	Phosphatidylinositol-3-phosphatase SAC1 (EC 3.1.3.64) (Phosphatidylinositol-4-phosphate phosphatase) (Recessive suppressor of secretory defect)	EBI-3664260	0.35
Q08873	Transgelin (Calponin homolog 1)	EBI-3664268	0.35
P40509	Coatomer subunit epsilon (Epsilon-coat protein) (Epsilon-COP)	EBI-3664284	0.35
P38968	Protein transport protein SEC31 (Protein WEB1)	EBI-3664292	0.35
O94742	26S proteasome complex subunit SEM1	EBI-3664300	0.35
P46995	Histone-lysine N-methyltransferase, H3 lysine-36 specific (EC 2.1.1.359) (Lysine N-methyltransferase 3) (SET domain-containing protein 2)	EBI-3664308	0.35
P53953	SED5-binding protein 2 (SEC24-related protein 2)	EBI-3664316	0.35
P23293	Serine/threonine-protein kinase BUR1 (EC 2.7.11.22) (EC 2.7.11.23) (Bypass UAS requirement protein 1) (Suppressor of GPA1-Vall50 mutation protein 1)	EBI-3664324	0.35
P51534	SWI5-dependent HO expression protein 4	EBI-3664332	0.35
P11978	Regulatory protein SIR4 (Silent information regulator 4)	EBI-3664340	0.35
Q04195	E3 SUMO-protein ligase SIZ1 (EC 2.3.2.-) (E3 SUMO-protein transferase SIZ2) (SAP and Miz-finger domain-containing protein 1) (Ubiquitin-like protein ligase 1)	EBI-3664348	0.35
P53327	RQC trigger complex helicase SLH1 (EC 3.6.4.13) (Antiviral helicase SLH1) (SKI2-like helicase 1)	EBI-3664356	0.35
P38989	Structural maintenance of chromosomes protein 2 (DA-box protein SMC2)	EBI-3664364	0.35
P47037	Structural maintenance of chromosomes protein 3 (DA-box protein SMC3)	EBI-3664372	0.35
P36048	Pre-mRNA-splicing factor SNU114 (114 kDa U5 small nuclear ribonucleoprotein component) (Growth inhibitory protein 10)	EBI-3664380	0.35
Q04053	Sorting nexin-41	EBI-3664388	0.35
P38633	Mediator of RNA polymerase II transcription subunit 31 (Hpr1 suppressor protein 1) (Mediator complex subunit 31)	EBI-3664396	0.35
P38863	Spindle pole body component SPC97	EBI-3664404	0.35
P23561	Serine/threonine-protein kinase STE11 (EC 2.7.11.25)	EBI-3664412	0.35
P05453	Eukaryotic peptide chain release factor GTP-binding subunit (ERF-3) (ERF3) (ERF2) (G1 to S phase transition protein 1) (Omnipotent suppressor protein 2) (PSI no more protein 2) (Polypeptide release factor 3) (Translation release factor 3)	EBI-3664420	0.35
P53201	SWR1-complex protein 4 (ESA1-associated factor 2)	EBI-3664428	0.35
P09959	Regulatory protein SWI6 (Cell-cycle box factor subunit SWI6) (MBF subunit P90) (Trans-acting activator of HO endonuclease gene)	EBI-3664436	0.35
Q05471	Helicase SWR1 (EC 3.6.4.12) (Swi2/Snf2-related 1)	EBI-3664444	0.35
Q12297	Transcription initiation factor TFIID subunit 3 (TAFII-47) (TAFII47) (TBP-associated factor 3) (TBP-associated factor 47 kDa)	EBI-3664460	0.35
P33339	Transcription factor tau 131 kDa subunit (TFIIIC 131 kDa subunit) (Transcription factor C subunit 4)	EBI-3664468	0.35
Q06339	Transcription factor tau 91 kDa subunit (TFIIIC 91 kDa subunit) (Transcription factor C subunit 6)	EBI-3664476	0.35
P17423	Homoserine kinase (HK) (HSK) (EC 2.7.1.39)	EBI-3664484	0.35
P23254	Transketolase 1 (TK 1) (EC 2.2.1.1)	EBI-3664492	0.35
P40462	Protein TMA108 (EC 3.4.11.-) (108 kDa translation machinery-associated protein)	EBI-3664500	0.35
P53840	Topoisomerase 1-associated factor 1	EBI-3664508	0.35
Q03280	E3 ubiquitin-protein ligase TOM1 (EC 2.3.2.26) (HECT-type E3 ubiquitin transferase TOM1) (Suppressor of snRNA protein 2) (Temperature-dependent organization in mitotic nucleus protein 1)	EBI-3664516	0.35
P06786	DNA topoisomerase 2 (EC 5.6.2.2) (DNA topoisomerase II)	EBI-3664524	0.35
P43637	Serine/threonine-protein kinase TOS3 (EC 2.7.11.1) (Target of SBF protein 3)	EBI-3664532	0.35
P06244	cAMP-dependent protein kinase type 1 (PKA 1) (EC 2.7.11.11) (CDC25-suppressing protein kinase) (PK-25)	EBI-3664540	0.35
Q00764	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 56 kDa subunit (EC 2.4.1.15) (General glucose sensor subunit 1) (Glycogen metabolism control protein GLC6) (Trehalose synthase complex catalytic subunit TPS1) (Trehalose-6-phosphate synthase) (UDP-glucose-glucosephosphate glucosyltransferase)	EBI-3664548	0.35
P38426	Trehalose synthase complex regulatory subunit TPS3 (Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 115 kDa subunit)	EBI-3664556	0.35
P38811	Transcription-associated protein 1 (p400 kDa component of SAGA)	EBI-3664564	0.35
Q07527	tRNA (guanosine(18)-2'-O)-methyltransferase (EC 2.1.1.34) (tRNA [Gm18] ribose methylase) (tRNA methyltransferase 3)	EBI-3664572	0.35
P00937	Multifunctional tryptophan biosynthesis protein [Includes: Anthranilate synthase component 2 (AS) (EC 4.1.3.27) (Anthranilate synthase, glutamine amidotransferase component); Indole-3-glycerol phosphate synthase (EC 4.1.1.48) (PRAI)]	EBI-3664580	0.35
P38427	Trehalose synthase complex regulatory subunit TSL1 (Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 123 kDa subunit)	EBI-3664588	0.35
Q07381	Ribosome biogenesis protein TSR1 (20S rRNA accumulation protein 1)	EBI-3664596	0.35
P53378	Tubulin gamma chain (Gamma-tubulin)	EBI-3664604	0.35
P36164	Golgi apparatus membrane protein TVP38 (TLG2-vesicle protein of 38 kDa)	EBI-3664612	0.35
Q08960	S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase (EC 4.1.3.44) (tRNA wybutosine-synthesizing protein 1)	EBI-3664620	0.35
Q01476	Ubiquitin carboxyl-terminal hydrolase 2 (EC 3.4.19.12) (Deubiquitinating enzyme 2) (Ubiquitin thioesterase 2) (Ubiquitin-specific-processing protease 2)	EBI-3664628	0.35
P43593	Ubiquitin carboxyl-terminal hydrolase 6 (EC 3.4.19.12) (Deubiquitinating enzyme 6) (Ubiquitin thioesterase 6) (Ubiquitin-specific-processing protease 6)	EBI-3664636	0.35
P54860	E4 ubiquitin-protein ligase UFD2 (EC 2.3.2.27) (RING-type E3 ubiquitin transferase UFD2) (Ubiquitin conjugation factor E4) (Ubiquitin fusion degradation protein 2) (UB fusion protein 2)	EBI-3664644	0.35
P33202	Ubiquitin fusion degradation protein 4 (UB fusion protein 4) (EC 2.3.2.-) (HECT-type E3 ubiquitin transferase UFD4) (EC 2.3.2.26)	EBI-3664652	0.35
P38067	Succinate-semialdehyde dehydrogenase [NADP(+)] (SSDH) (EC 1.2.1.16)	EBI-3664660	0.35
P28274	CTP synthase 1 (EC 6.3.4.2) (CTP synthetase 1) (UTP--ammonia ligase 1)	EBI-3664668	0.35
P42945	U3 small nucleolar RNA-associated protein 10 (U3 snoRNA-associated protein 10) (U three protein 10) (U3 protein 10 required for transcription) (t-UTP10)	EBI-3664676	0.35
Q05946	U3 small nucleolar RNA-associated protein 13 (U3 snoRNA-associated protein 13) (U three protein 13)	EBI-3664684	0.35
Q06078	U3 small nucleolar RNA-associated protein 21 (U3 snoRNA-associated protein 21) (U three protein 21)	EBI-3664692	0.35
P53276	U3 small nucleolar RNA-associated protein 8 (U3 snoRNA-associated protein 8) (U three protein 8) (U3 protein 8 required for transcription) (t-UTP8)	EBI-3664700	0.35
P32623	Probable glycosidase CRH2 (EC 3.2.-.-) (Congo red hypersensitive protein 2) (Unknown transcript 2 protein)	EBI-3664708	0.35
P53076	Vacuolar import and degradation protein 30 (Glucose-induced degradation protein 1)	EBI-3664716	0.35
Q12045	Spindle pole body-associated protein VIK1 (Vegetative interaction with KAR3 protein 1)	EBI-3664724	0.35
Q06685	Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase (EC 2.7.4.24) (InsP6 and PP-IP5 kinase)	EBI-3664732	0.35
P34110	Vacuolar protein sorting-associated protein 35 (Vacuolar protein-targeting protein 7)	EBI-3664740	0.35
Q12109	Tryptophan--tRNA ligase, cytoplasmic (EC 6.1.1.2) (Tryptophanyl-tRNA synthetase) (TrpRS)	EBI-3664748	0.35
P39735	Single-strand annealing weakened protein 1	EBI-3664756	0.35
P46683	Ankyrin repeat-containing protein YAR1	EBI-3664764	0.35
P38222	Ribosomal lysine N-methyltransferase 3 (EC 2.1.1.-)	EBI-3664772	0.35
P38317	Uncharacterized protein YBR219C	EBI-3664780	0.35
P25361	Uncharacterized protein YCR043C	EBI-3664788	0.35
Q04093	Putative lipase YDR444W (EC 3.1.-.-)	EBI-3664796	0.35
P16521	Elongation factor 3A (EF-3) (EF-3A) (EC 3.6.4.-) (Eukaryotic elongation factor 3) (eEF3) (Translation elongation factor 3A) (Yeast elongation factor 3)	EBI-3664812	0.35
P43594	MICOS complex subunit MIC19 (Altered inheritance of mitochondria protein 13, mitochondrial) (Mitochondrial contact site complex 19 kDa subunit)	EBI-3664820	0.35
P53262	V0 assembly protein 1	EBI-3664828	0.35
P38829	MIP18 family protein YHR122W	EBI-3664836	0.35
P38833	Uncharacterized protein YHR127W	EBI-3664844	0.35
P40533	Protein TED1 (Trafficking of EMP24/ERV25-dependent cargo disrupted protein 1)	EBI-3664852	0.35
P36114	IML2-like protein YKR018C	EBI-3664860	0.35
Q05778	Proteasome chaperone 1 (Proteasome biogenesis-associated protein 1)	EBI-3664868	0.35
Q06188	PWWP domain-containing protein YLR455W	EBI-3664876	0.35
Q04847	Non-SCF-type F-box protein ROY1 (Repressor of YPT52)	EBI-3664884	0.35
P53970	Protein-lysine N-methyltransferase EFM6 (EC 2.1.1.-) (Elongation factor methyltransferase 6)	EBI-3664892	0.35
P42842	Essential for maintenance of the cell wall protein 1	EBI-3664900	0.35
Q08206	Uncharacterized protein YOL036W	EBI-3664908	0.35
Q08548	Lysophospholipid acyltransferase (LPLAT) (EC 2.3.1.23) (EC 2.3.1.51) (EC 2.3.1.n6) (EC 2.3.1.n7) (1-acyl-sn-glycerol-3-phosphate acyltransferase) (AGPAT) (Lysophosphatidic acid acyltransferase) (LPAAT) (Lysophosphatidylcholine acyltransferase) (LPCAT) (Lysophosphatidylethanolamine acyltransferase) (LPEAT) (Lysophosphatidylserine acyltransferase) (LPSAT) (Sphingolipid compensation protein 4)	EBI-3664916	0.35
Q08822	Probable electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial (ETF-QO) (ETF-ubiquinone oxidoreductase) (EC 1.5.5.1) (Changed intracellular redox state protein 2) (Electron-transferring-flavoprotein dehydrogenase) (ETF dehydrogenase)	EBI-3664924	0.35
P12688	Serine/threonine-protein kinase YPK1 (EC 2.7.11.1) (Sphingosine-like immunosuppressant resistant protein 2) (Yeast protein kinase 1)	EBI-3664932	0.35
Q08924	Regulator of Ty1 transposition protein 10 (Endosomal recycling protein 2) (tRNA (guanosine(34)-2'-O)-methyltransferase non-catalytic subunit TRM734)	EBI-3664940	0.35
O13585	Dilute domain-containing protein YPR089W	EBI-3664948	0.35
Q06109	Required for respiratory growth protein 8, mitochondrial	EBI-3664956	0.35
Q08245	Protein ZEO1 (Zeocin resistance protein 1)	EBI-3664964	0.35
P53303	Zinc finger protein ZPR1	EBI-3664972	0.35
P11412	Glucose-6-phosphate 1-dehydrogenase (G6PD) (EC 1.1.1.49)	EBI-3664980	0.35
P15108	ATP-dependent molecular chaperone HSC82 (82 kDa heat shock cognate protein) (Heat shock protein Hsp90 constitutive isoform)	EBI-3664988	0.35
P47138	Diphthamide biosynthesis protein 4 (J protein type 3)	EBI-3664996	0.35
P10591	Heat shock protein SSA1 (Heat shock protein YG100)	EBI-3682766	0.53
P09435	Heat shock protein SSA3	EBI-3683827	0.35
P39987	Heat shock protein SSC3, mitochondrial (Extracellular mutant protein 10)	EBI-3703899	0.35
P10592	Heat shock protein SSA2	EBI-3719486	0.35
P33416	Heat shock protein 78, mitochondrial	EBI-3748847	0.35
P31539	Heat shock protein 104 (Protein aggregation-remodeling factor HSP104)	EBI-3749791	0.35
Q12329	Heat shock protein 42 (42 kDa heat shock protein)	EBI-3751647	0.35
P32048	Lysine--tRNA ligase, mitochondrial (EC 6.1.1.6) (Lysyl-tRNA synthetase) (LysRS)	EBI-3752007	0.35
P06103	Eukaryotic translation initiation factor 3 subunit B (eIF3b) (Cell cycle regulation and translation initiation protein) (Eukaryotic translation initiation factor 3 90 kDa subunit) (eIF3 p90) (Translation initiation factor eIF3 p90 subunit)	EBI-3752015	0.35
P04786	DNA topoisomerase 1 (EC 5.6.2.1) (DNA topoisomerase I) (Maintenance of killer protein 1)	EBI-3752023	0.35
P53852	Cysteine--tRNA ligase (EC 6.1.1.16) (Cysteinyl-tRNA synthetase) (CysRS)	EBI-3752031	0.35
P15992	Heat shock protein 26 (26 kDa heat shock protein)	EBI-3752039	0.35
P11484	Ribosome-associated molecular chaperone SSB1 (EC 3.6.4.10) (Cold-inducible protein YG101) (Heat shock protein SSB1) (Hsp70 chaperone Ssb)	EBI-3752047	0.35
P32589	Heat shock protein homolog SSE1 (Chaperone protein MSI3)	EBI-3752055	0.35
P42884	Putative aryl-alcohol dehydrogenase AAD14 (EC 1.1.1.-)	EBI-3763499	0.35
P37898	Alanine/arginine aminopeptidase (EC 3.4.11.-)	EBI-3763507	0.35
Q03266	Aminodeoxychorismate lyase (EC 4.1.3.38) (4-amino-4-deoxychorismate lyase) (ADC lyase) (ADCL)	EBI-3763515	0.35
Q00955	Acetyl-CoA carboxylase (ACC) (EC 6.4.1.2) (Fatty acid synthetase 3) (mRNA transport-defective protein 7) [Includes: Biotin carboxylase (EC 6.3.4.14)]	EBI-3763523	0.35
P21192	Metallothionein expression activator	EBI-3763531	0.35
Q07622	Activator of C kinase protein 1	EBI-3763539	0.35
P60010	Actin (EC 3.6.4.-)	EBI-3763547	0.35
Q07732	Accumulates dyads protein 3	EBI-3763555	0.35
P22136	ATPase expression protein 2, mitochondrial	EBI-3763563	0.35
Q12449	Hsp90 co-chaperone AHA1 (Activator of Hsp90 ATPase protein 1)	EBI-3763571	0.35
P03875	Putative COX1/OXI3 intron 1 protein	EBI-3763579	0.35
Q9ZZX1	Intron-encoded DNA endonuclease aI5 alpha (DNA endonuclease I-SceIV) [Cleaved into: Truncated non-functional cytochrome oxidase 1; DNA endonuclease aI5 alpha (EC 3.1.-.-) (Intron-encoded endonuclease I-SceIV)]	EBI-3763587	0.35
Q12013	Probable palmitoyltransferase AKR2 (EC 2.3.1.225) (Ankyrin repeat-containing protein AKR2)	EBI-3763595	0.35
P47029	Arrestin-related trafficking adapter 3 (Arrestin-like protein 2)	EBI-3763603	0.35
P22108	Diadenosine 5',5'''-P1,P4-tetraphosphate phosphorylase 2 (Ap4A phosphorylase 2) (EC 2.7.7.53) (ADP-sulfurylase) (EC 2.7.7.5) (ATP adenylyltransferase)	EBI-3763611	0.35
Q04601	Anaphase-promoting complex subunit 4	EBI-3763619	0.35
P38281	Actin patches distal protein 1	EBI-3763627	0.35
P27351	AP-2 complex subunit beta (Beta-2-adaptin) (Beta-adaptin) (Clathrin assembly protein complex 2 beta large chain) (Clathrin assembly protein large beta chain)	EBI-3763635	0.35
P38065	AP-2 complex subunit alpha (Alpha-adaptin) (Clathrin assembly protein complex 2 alpha large chain) (Clathrin assembly protein large alpha chain)	EBI-3763643	0.35
Q08951	AP-3 complex subunit delta (Adaptor-related protein complex 3 subunit delta) (Delta-adaptin 3) (Delta-adaptin)	EBI-3763651	0.35
P11076	ADP-ribosylation factor 1 (EC 3.6.5.2)	EBI-3763659	0.35
P04076	Argininosuccinate lyase (ASAL) (EC 4.3.2.1) (Arginosuccinase)	EBI-3763667	0.35
P38116	ADP-ribosylation factor-like protein 1 (Arf-like GTPase 1)	EBI-3763675	0.35
P08566	Pentafunctional AROM polypeptide [Includes: 3-dehydroquinate synthase (DHQS) (EC 4.2.3.4); 3-phosphoshikimate 1-carboxyvinyltransferase (EC 2.5.1.19) (5-enolpyruvylshikimate-3-phosphate synthase) (EPSP synthase) (EPSPS); Shikimate kinase (SK) (EC 2.7.1.71); 3-dehydroquinate dehydratase (3-dehydroquinase) (EC 4.2.1.10); Shikimate dehydrogenase (EC 1.1.1.25)]	EBI-3763683	0.35
Q04052	Transcriptional activator ARO80	EBI-3763691	0.35
P34233	Transcriptional regulatory protein ASH1 (Daughter cells HO repressor protein)	EBI-3763699	0.35
P39945	Protein AST2 (ATPAse stabilizing protein 1)	EBI-3763715	0.35
Q12527	Autophagy-related protein 11 (Cytoplasm to vacuole targeting protein 9)	EBI-3763723	0.35
P53855	Autophagy-related protein 2 (Sporulation-specific protein 72)	EBI-3763731	0.35
Q12142	Autophagy-related protein 9 (Cytoplasm to vacuole targeting protein 7)	EBI-3763739	0.35
P32453	Protein ATP11, mitochondrial	EBI-3763747	0.35
Q08236	Target of rapamycin complex 2 subunit AVO1 (TORC2 subunit AVO1) (Adheres voraciously to TOR2 protein 1)	EBI-3763755	0.35
P47068	Myosin tail region-interacting protein MTI1 (Protein BBC1)	EBI-3763763	0.35
Q01389	Serine/threonine-protein kinase BCK1/SLK1/SSP31 (EC 2.7.11.1)	EBI-3763771	0.35
P46678	Transcription factor TFIIIB component B'' (TFIIIB90)	EBI-3763779	0.35
Q08347	Alkyl/aryl-sulfatase BDS1 (EC 3.1.6.-) (Bacterially-derived sulfatase 1)	EBI-3763787	0.35
P39960	GTPase-activating protein BEM2/IPL2 (Bud emergence protein 2)	EBI-3763800	0.35
P43583	Proteasome activator BLM10 (Bleomycin resistance protein BLM10)	EBI-3763808	0.35
Q08965	Ribosome biogenesis protein BMS1	EBI-3763816	0.35
P47125	Indoleamine 2,3-dioxygenase (IDO) (EC 1.13.11.52) (Biosynthesis of nicotinic acid protein 2)	EBI-3763824	0.35
P41832	Protein BNI1 (Pointed projection formation protein 3) (Sensitive to high expression protein 5) (Synthetic lethal 39)	EBI-3763832	0.35
P40450	BNI1-related protein 1	EBI-3763840	0.35
P38041	Protein BOB1 (BEM1-binding protein) (Growth inhibitory protein 7)	EBI-3763848	0.35
P39969	Protein BOI2 (Protein BEB1)	EBI-3763856	0.35
P25385	Protein transport protein BOS1 (Bet one suppressor 1)	EBI-3763864	0.35
P25356	Beige protein homolog 1	EBI-3763872	0.35
P33314	Inhibitory regulator protein BUD2/CLA2 (Bud site selection protein 2)	EBI-3763880	0.35
P41697	Bud site selection protein 6 (Actin-interacting protein 3)	EBI-3763888	0.35
P48524	Ubiquitin ligase-binding protein BUL1 (Respiration deficiency suppressor 1)	EBI-3763896	0.35
P53280	Protein CAF130 (130 kDa CCR4-associated factor)	EBI-3763904	0.35
P29547	Elongation factor 1-gamma 1 (EF-1-gamma 1) (Calcium and membrane-binding protein 1) (Calcium phospholipid-binding protein) (CPBP) (Eukaryotic elongation factor 1Bgamma 1) (eEF1Bgamma 1) (Translation elongation factor 1B gamma 1)	EBI-3763912	0.35
P28495	F-actin-capping protein subunit alpha	EBI-3763920	0.35
P53894	Serine/threonine-protein kinase CBK1 (EC 2.7.11.1) (Cell wall biosynthesis kinase)	EBI-3763928	0.35
P38626	NADH-cytochrome b5 reductase 1 (EC 1.6.2.2) (Microsomal cytochrome b reductase) (P35)	EBI-3763936	0.35
Q03702	Cruciform cutting endonuclease 1, mitochondrial (EC 3.1.21.10)	EBI-3763944	0.35
P00549	Pyruvate kinase 1 (PK 1) (EC 2.7.1.40) (cell division cycle protein 19)	EBI-3763952	0.35
P26309	APC/C activator protein CDC20 (Cell division control protein 20)	EBI-3763960	0.53
P06785	Thymidylate synthase (TS) (TSase) (EC 2.1.1.45) (Cell division cycle protein 21) (Constitutive RNR3 transcription protein 9)	EBI-3763968	0.35
P25655	General negative regulator of transcription subunit 1 (Cell division cycle protein 39)	EBI-3763976	0.35
P07834	Cell division control protein 4 (E3 ubiquitin ligase complex SCF subunit CDC4) (F-box protein CDC4)	EBI-3763984	0.35
Q08032	Cell division control protein 45	EBI-3763992	0.35
P25694	Cell division control protein 48 (EC 3.6.4.6) (Cell division cycle protein 48) (Transitional endoplasmic reticulum ATPase homolog)	EBI-3764000	0.35
P30665	DNA replication licensing factor MCM4 (EC 3.6.4.12) (Cell division control protein 54)	EBI-3764008	0.35
P39525	3-oxoacyl-[acyl-carrier-protein] synthase homolog (EC 2.3.1.41) (Beta-ketoacyl-ACP synthase homolog)	EBI-3764016	0.35
O13297	mRNA-capping enzyme subunit beta (EC 3.6.1.74) (mRNA 5'-phosphatase) (mRNA 5'-triphosphate monophosphatase)	EBI-3764024	0.35
Q12453	Cytoplasmic export protein 1	EBI-3764032	0.35
Q06632	Protein CFT1 (Cleavage factor two protein 1)	EBI-3764040	0.35
P32657	Chromo domain-containing protein 1 (EC 3.6.4.-) (ATP-dependent helicase CHD1)	EBI-3764048	0.35
P22516	ATP-dependent DNA helicase CHL1 (EC 3.6.4.12) (Chromosome loss protein 1) (Chromosome transmission fidelity protein 1)	EBI-3764056	0.35
P29465	Chitin synthase 3 (EC 2.4.1.16) (Chitin-UDP acetyl-glucosaminyl transferase 3) (Class-IV chitin synthase 3)	EBI-3764064	0.35
P38779	Proteasome-interacting protein CIC1 (Core interacting component 1)	EBI-3764072	0.35
P40987	Chromosome instability protein 1	EBI-3764080	0.35
P27895	Kinesin-like protein CIN8 (Chromosome instability protein 8)	EBI-3764088	0.35
P20485	Choline kinase (EC 2.7.1.32) (ATP:choline phosphotransferase)	EBI-3764096	0.35
P48562	Serine/threonine-protein kinase CLA4 (EC 2.7.11.1)	EBI-3764104	0.35
Q08685	mRNA cleavage and polyadenylation factor CLP1	EBI-3764112	0.35
Q03690	Clustered mitochondria protein 1 (Translation initiation factor 31) (eIF3-associated protein p135)	EBI-3764120	0.35
P06787	Calmodulin (CaM)	EBI-3764128	0.35
P23287	Serine/threonine-protein phosphatase 2B catalytic subunit A1 (EC 3.1.3.16) (Calcineurin A1) (Calmodulin-binding protein 1)	EBI-3764136	0.53
Q04632	Conserved oligomeric Golgi complex subunit 8 (COG complex subunit 8) (Component of oligomeric Golgi complex 8)	EBI-3764144	0.35
P53622	Coatomer subunit alpha (Alpha-coat protein) (Alpha-COP) (Retrieval from endoplasmic reticulum protein 1) (Secretory protein 22) (Suppressor of osmo-sensitivity 1)	EBI-3764152	0.35
P49017	2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial (EC 2.1.1.201) (2-hexaprenyl-6-methoxy-1,4-benzoquinol methyltransferase) (Ubiquinone biosynthesis methyltransferase COQ5)	EBI-3764160	0.35
Q04935	Cytochrome c oxidase assembly protein COX20, mitochondrial	EBI-3764168	0.35
P23285	Peptidyl-prolyl cis-trans isomerase B (PPIase B) (EC 5.2.1.8) (Cyclophilin B) (Cyclophilin-related protein) (Rotamase B)	EBI-3764176	0.35
P33307	Importin alpha re-exporter (Chromosome segregation protein CSE1)	EBI-3764184	0.35
Q12734	Transcription factor CSR2 (CHS5 SPA2 rescue protein 2)	EBI-3764192	0.35
Q01454	DNA polymerase alpha-binding protein (Chromosome replication protein CHL15) (Chromosome transmission fidelity protein 4) (Protein POB1)	EBI-3764200	0.35
P89105	RNA polymerase-associated protein CTR9 (Centromere-binding factor 1-dependent protein 1) (Cln three-requiring protein 9)	EBI-3764208	0.56
P53008	Mannosyl-oligosaccharide glucosidase (EC 3.2.1.106) (Processing A-glucosidase I) (Glucosidase I)	EBI-3764216	0.35
P32898	Mitochondrial presequence protease (EC 3.4.24.-) (Cytosolic metalloprotease 1) (Metalloprotease of 112 kDa)	EBI-3764224	0.35
P08678	Adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase)	EBI-3764232	0.35
P32582	Cystathionine beta-synthase (EC 4.2.1.22) (Beta-thionase) (Serine sulfhydrase) (Sulfur transfer protein 4)	EBI-3764240	0.35
Q12389	ATP-dependent RNA helicase DBP10 (EC 3.6.4.13) (DEAD box protein 10)	EBI-3764248	0.35
P06634	ATP-dependent RNA helicase DED1 (EC 3.6.4.13) (DEAD box protein 1) (Defines essential domain protein 1)	EBI-3764264	0.35
Q08496	Protein DIA2 (Digs into agar protein 2)	EBI-3764272	0.53
P25453	Meiotic recombination protein DMC1	EBI-3764280	0.53
P38859	DNA replication ATP-dependent helicase/nuclease DNA2 [Includes: DNA replication nuclease DNA2 (EC 3.1.-.-); DNA replication ATP-dependent helicase DNA2 (EC 3.6.4.12)]	EBI-3764288	0.35
Q12675	Phospholipid-transporting ATPase DNF2 (EC 7.6.2.1) (Flippase DNF2)	EBI-3764296	0.35
Q12674	Probable phospholipid-transporting ATPase DNF3 (EC 7.6.2.1) (Aminophospholipid translocase) (APT) (Phospholipid translocase) (PLT)	EBI-3764304	0.35
Q08387	DNA ligase 4 (EC 6.5.1.1) (DNA ligase II) (DNA ligase IV) (Polydeoxyribonucleotide synthase [ATP] 4)	EBI-3764312	0.35
P54861	Dynamin-related protein DNM1 (EC 3.6.5.5)	EBI-3764320	0.35
Q05610	Donuts protein 1	EBI-3764328	0.35
Q03921	Protein dopey	EBI-3764336	0.35
P24482	DNA polymerase epsilon subunit B (DNA polymerase II subunit 2)	EBI-3764344	0.35
P53847	Protein transport protein DSL1 (Dependent on SLY1-20 protein 1)	EBI-3764352	0.35
P38149	Probable di- and tripeptidase DUG2 (EC 3.4.-.-) (Deficient in utilization of glutathione protein 2) (GSH degradosomal complex subunit DUG2)	EBI-3764360	0.35
Q12432	Chromatin modification-related protein EAF3 (ESA1-associated factor 3)	EBI-3764368	0.35
Q04110	Protein ECM11 (Extracellular mutant protein 11)	EBI-3764376	0.35
Q04217	Probable ATP-dependent RNA helicase DHR1 (EC 3.6.4.13) (DEAH box RNA helicase DHR1) (Extracellular mutant protein 16)	EBI-3764384	0.35
Q05958	Sterol regulatory element-binding protein ECM22 (Extracellular mutant protein 22)	EBI-3764392	0.35
P32525	Protein ECM25 (Extracellular matrix protein 25)	EBI-3764400	0.35
Q06673	Protein ECM30 (Extracellular mutant protein 30)	EBI-3764416	0.35
Q03214	Protein ECM5 (Extracellular matrix protein 5)	EBI-3764424	0.35
P40557	ER-retained PMA1-suppressing protein 1 (EC 5.3.4.1)	EBI-3764440	0.35
P10614	Lanosterol 14-alpha demethylase CYP51 (EC 1.14.14.154) (Cytochrome P450 51) (Cytochrome P450-14DM) (Cytochrome P450-LIA1) (CYPLI) (Ergosterol biosynthetic protein 11) (Sterol 14-alpha demethylase)	EBI-3764448	0.35
Q03018	Separin (EC 3.4.22.49) (Separase)	EBI-3764456	0.35
Q06163	Telomerase reverse transcriptase (EC 2.7.7.49) (Telomerase catalytic subunit)	EBI-3764469	0.35
P34756	1-phosphatidylinositol 3-phosphate 5-kinase FAB1 (Phosphatidylinositol 3-phosphate 5-kinase) (EC 2.7.1.150) (Formation of aploid and binucleate cells protein 1) (Styryl dye vacuolar localization protein 7) (Type III PIP kinase) (PIPkin-III)	EBI-3764477	0.35
P53971	FKBP12-associated protein 1	EBI-3764485	0.35
P46671	Factor arrest protein 3	EBI-3764493	0.35
P19097	Fatty acid synthase subunit alpha (EC 2.3.1.86) [Includes: Acyl carrier; 3-oxoacyl-[acyl-carrier-protein] reductase (EC 1.1.1.100) (Beta-ketoacyl reductase); 3-oxoacyl-[acyl-carrier-protein] synthase (EC 2.3.1.41) (Beta-ketoacyl synthase)]	EBI-3764501	0.35
P14540	Fructose-bisphosphate aldolase (FBP aldolase) (FBPA) (EC 4.1.2.13) (Fructose-1,6-bisphosphate aldolase)	EBI-3764509	0.35
P39521	Pre-rRNA-processing protein FHL1	EBI-3764517	0.35
P32785	Methionyl-tRNA formyltransferase, mitochondrial (MtFMT) (EC 2.1.2.9)	EBI-3764525	0.35
P53848	Folic acid synthesis protein FOL1 [Includes: Dihydroneopterin aldolase (DHNA) (EC 4.1.2.25) (7,8-dihydroneopterin aldolase) (FASA) (FASB); 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase (HPPK) (EC 2.7.6.3) (2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase) (7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase) (PPPK) (FASC); Dihydropteroate synthase (DHPS) (EC 2.5.1.15) (Dihydropteroate pyrophosphorylase) (FASD)]	EBI-3764533	0.35
P38911	Peptidyl-prolyl cis-trans isomerase (PPIase) (EC 5.2.1.8) (FK506-binding nuclear protein) (FKBP-70) (Nucleolar proline isomerase) (Proline rotamase)	EBI-3764541	0.35
Q12333	Ferric/cupric reductase transmembrane component 7 (EC 1.16.1.9) (Ferric-chelate reductase 7)	EBI-3764549	0.35
P31380	ATP-dependent helicase FUN30 (EC 3.6.4.12)	EBI-3764557	0.35
P46949	Protein FYV8 (Function required for yeast viability protein 8)	EBI-3764565	0.35
P38297	Mitofusin FZO1 (EC 3.6.5.-) (Transmembrane GTPase FZO1)	EBI-3764573	0.35
P09032	Translation initiation factor eIF-2B subunit gamma (GCD complex subunit GCD1) (Guanine nucleotide exchange factor subunit GCD1) (eIF-2B GDP-GTP exchange factor subunit gamma)	EBI-3764581	0.35
P32481	Eukaryotic translation initiation factor 2 subunit gamma (eIF-2-gamma) (EC 3.6.5.3)	EBI-3764589	0.35
P32501	Translation initiation factor eIF-2B subunit epsilon (GCD complex subunit GCD6) (Guanine nucleotide exchange factor subunit GCD6) (eIF-2B GDP-GTP exchange factor subunit epsilon)	EBI-3764597	0.35
Q03330	Histone acetyltransferase GCN5 (EC 2.3.1.48) (Histone crotonyltransferase GCN5) (EC 2.3.1.-)	EBI-3764613	0.35
Q06625	Glycogen debranching enzyme (Glycogen debrancher) [Includes: 4-alpha-glucanotransferase (EC 2.4.1.25) (Oligo-1,4-1,4-glucantransferase); Amylo-alpha-1,6-glucosidase (Amylo-1,6-glucosidase) (EC 3.2.1.33) (Dextrin 6-alpha-D-glucosidase)]	EBI-3764621	0.35
P47102	ARF guanine-nucleotide exchange factor 1	EBI-3764629	0.35
P53192	Golgi to ER traffic protein 1 (Guided entry of tail-anchored proteins 1) (Mitochondrial distribution and morphology protein 39)	EBI-3764637	0.35
Q03016	GLC7-interacting protein 3	EBI-3764645	0.35
Q12680	Glutamate synthase [NADH] (EC 1.4.1.14) (NADH-GOGAT)	EBI-3764653	0.35
P08539	Guanine nucleotide-binding protein alpha-1 subunit (GP1-alpha)	EBI-3764661	0.35
P41911	Glycerol-3-phosphate dehydrogenase [NAD(+)] 2, mitochondrial (EC 1.1.1.8)	EBI-3764669	0.35
P00950	Phosphoglycerate mutase 1 (PGAM 1) (EC 5.4.2.11) (BPG-dependent PGAM 1) (MPGM 1) (Phosphoglyceromutase 1)	EBI-3764677	0.35
P25373	Glutaredoxin-1 (EC 1.11.1.9) (EC 2.5.1.18) (Glutathione-dependent oxidoreductase 1)	EBI-3764685	0.35
P32477	Glutamate--cysteine ligase (EC 6.3.2.2) (Gamma-ECS) (GCS) (Gamma-glutamylcysteine synthetase)	EBI-3764693	0.35
P48239	Glutathione S-transferase omega-like 1 (EC 2.5.1.18) (Glutathione-dependent dehydroascorbate reductase) (EC 1.8.5.1)	EBI-3764701	0.35
Q08929	Membrane-bound O-acyltransferase GUP2 (Glycerol uptake protein 2)	EBI-3764714	0.35
Q05775	Eukaryotic translation initiation factor 3 subunit J (eIF3j) (Eukaryotic translation initiation factor 3 30 kDa subunit) (eIF-3 30 kDa) (High-copy suppressor of Rpg1 protein 1)	EBI-3764722	0.35
P40012	Protoporphyrinogen oxidase (PPO) (EC 1.3.3.4)	EBI-3764730	0.35
P32874	Acetyl-CoA carboxylase, mitochondrial (ACC) (EC 6.4.1.2) [Includes: Biotin carboxylase (EC 6.3.4.14)]	EBI-3764738	0.35
P48362	Protein HGH1 (HMG1/2 protein homolog)	EBI-3764746	0.35
P02309	Histone H4	EBI-3764754	0.35
P33734	Imidazole glycerol phosphate synthase hisHF (IGP synthase) (IGPS) (ImGP synthase) (EC 4.3.2.10) [Includes: Glutaminase (EC 3.5.1.2); Cyclase]	EBI-3764762	0.35
Q08702	Aprataxin-like protein (EC 3.6.1.71) (EC 3.6.1.72) (Hit family protein 3)	EBI-3764770	0.35
Q05080	Cytokinesis protein 2 (Homolog of CDC15 protein 1)	EBI-3764778	0.35
P40480	Protein HOS4	EBI-3764786	0.35
Q05787	ERAD-associated E3 ubiquitin-protein ligase component HRD3 (HMG-CoA reductase degradation protein 3)	EBI-3764794	0.35
Q05549	ATP-dependent helicase HRQ1 (EC 3.6.4.12) (Homologous to recQ protein 1)	EBI-3764802	0.35
Q12385	1-acylglycerol-3-phosphate O-acyltransferase ICT1 (EC 2.3.1.51) (Increased copper tolerance protein 1) (Lysophosphatidic acid acyltransferase ICT1) (LPAAT)	EBI-3764810	0.35
P53982	Isocitrate dehydrogenase [NADP] (IDH) (EC 1.1.1.42) (IDP) (NADP(+)-specific ICDH) (Oxalosuccinate decarboxylase)	EBI-3764818	0.35
P25038	Translation initiation factor IF-2, mitochondrial (IF-2(Mt)) (IF-2Mt) (IF2(mt))	EBI-3764826	0.35
P53897	mRNA stability protein IGO1 (Initiation of G zero protein 1)	EBI-3764834	0.35
Q06706	Elongator complex protein 1 (Gamma-toxin target 1) (Protein IKI3)	EBI-3764842	0.35
P25605	Acetolactate synthase small subunit, mitochondrial (Acetohydroxy-acid synthase small subunit) (AHAS) (ALS)	EBI-3764850	0.35
P25642	54S ribosomal protein IMG2, mitochondrial (Integrity of mitochondrial genome protein 2) (Mitochondrial large ribosomal subunit protein mL49)	EBI-3764858	0.35
Q06704	Golgin IMH1 (Integrins and myosins homology protein 1)	EBI-3764866	0.35
P47170	Vacuolar membrane-associated protein IML1 (Increased minichromosome loss protein 1) (SEH-associated protein 1)	EBI-3764874	0.35
P50942	Polyphosphatidylinositol phosphatase INP52 (Synaptojanin-like protein 2) [Includes: SAC1-like phosphoinositide phosphatase (EC 3.1.3.-); Phosphatidylinositol 4,5-bisphosphate 5-phosphatase (EC 3.1.3.36)]	EBI-3764882	0.35
Q12271	Polyphosphatidylinositol phosphatase INP53 (Suppressor of PMA1 protein 2) (Synaptojanin-like protein 3) [Includes: SAC1-like phosphoinositide phosphatase (EC 3.1.3.-); Phosphatidylinositol 4,5-bisphosphate 5-phosphatase (EC 3.1.3.36)]	EBI-3764890	0.35
Q08227	Phosphatidylinositol 4,5-bisphosphate 5-phosphatase INP54 (EC 3.1.3.36)	EBI-3764898	0.35
P47056	Outer spore wall protein 6 (Increased recombination centers protein 18)	EBI-3764911	0.35
Q07843	Increased recombination centers protein 19 (Respiratory growth protein 4)	EBI-3764919	0.35
Q06554	Uncharacterized ATP-dependent helicase IRC20 (EC 3.6.1.-) (Increased recombination centers protein 20)	EBI-3764927	0.35
P40541	Cohesin subunit SCC3 (Irregular cell behavior protein 1)	EBI-3764935	0.35
P38250	Increased sodium tolerance protein 2	EBI-3764943	0.35
P38144	ISWI chromatin-remodeling complex ATPase ISW1 (EC 3.6.4.-)	EBI-3764951	0.35
P53125	Imitation switch two complex protein 1	EBI-3764959	0.35
Q12358	Alpha-ketoglutarate-dependent sulfonate dioxygenase (EC 1.14.11.-)	EBI-3764967	0.35
P38853	Kelch repeat-containing protein 1	EBI-3764983	0.35
P28742	Kinesin-like protein KIP1 (Chromosome instability protein 9)	EBI-3764991	0.35
P32350	Dual specificity protein kinase KNS1 (EC 2.7.12.1)	EBI-3764999	0.35
P38873	Target of rapamycin complex 1 subunit KOG1 (TORC1 subunit KOG1) (Kontroller of growth protein 1) (Local anesthetic-sensitive protein 24) (Regulatory-associated protein of TOR) (Raptor)	EBI-3765007	0.35
P27810	Alpha-1,2 mannosyltransferase KTR1 (EC 2.4.1.-)	EBI-3765015	0.35
P38130	Probable mannosyltransferase KTR3 (EC 2.4.1.-)	EBI-3765023	0.35
Q08963	U2 small nuclear ribonucleoprotein A' (U2 snRNP A') (Looks exceptionally like U2A protein 1)	EBI-3765031	0.35
P53598	Succinate--CoA ligase [ADP-forming] subunit alpha, mitochondrial (EC 6.2.1.5) (Succinyl-CoA synthetase subunit alpha) (SCS-alpha)	EBI-3765039	0.35
P53312	Succinate--CoA ligase [ADP-forming] subunit beta, mitochondrial (EC 6.2.1.5) (Succinyl-CoA synthetase beta chain) (SCS-beta)	EBI-3765047	0.35
P07866	Guanine nucleotide exchange factor LTE1 (Low temperature essential protein 1)	EBI-3765055	0.35
P40495	Homoisocitrate dehydrogenase, mitochondrial (HIcDH) (EC 1.1.1.87)	EBI-3765063	0.35
P40957	Spindle assembly checkpoint component MAD1 (Mitotic arrest deficient protein 1)	EBI-3765071	0.35
P29469	DNA replication licensing factor MCM2 (EC 3.6.4.12) (Minichromosome maintenance protein 2)	EBI-3765079	0.35
P24279	DNA replication licensing factor MCM3 (EC 3.6.4.12) (Minichromosome maintenance protein 3)	EBI-3765087	0.35
Q01846	Structural protein MDM1 (Mitochondrial distribution and morphology protein 1)	EBI-3765095	0.35
P38111	Serine/threonine-protein kinase MEC1 (EC 2.7.11.1) (ATR homolog) (DNA-damage checkpoint kinase MEC1) (Mitosis entry checkpoint protein 1)	EBI-3765103	0.35
P05694	5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase (EC 2.1.1.14) (Cobalamin-independent methionine synthase) (Delta-P8 protein) (Methionine synthase, vitamin-B12 independent isozyme)	EBI-3765111	0.35
P43638	MAP-homologous protein 1	EBI-3765119	0.35
P38760	RNA-binding protein MIP6 (MEX67-interacting protein 6)	EBI-3765135	0.35
P40850	Post-transcriptional regulator MKT1 (Inactive endonuclease MKT1)	EBI-3765143	0.35
Q07980	DNA mismatch repair protein MLH2 (MutL protein homolog 2)	EBI-3765151	0.35
Q12083	DNA mismatch repair protein MLH3 (MutL protein homolog 3)	EBI-3765159	0.35
P36044	Protein MNN4	EBI-3765183	0.35
P07884	tRNA dimethylallyltransferase (DMATase) (EC 2.5.1.75) (Isopentenyl-diphosphate: tRNA isopentenyltransferase) (IPP transferase) (IPPT) (tRNA isopentenyltransferase) (IPTase)	EBI-3765191	0.35
P32333	TATA-binding protein-associated factor MOT1 (TBP-associated factor MOT1) (EC 3.6.4.-) (Modifier of transcription 1)	EBI-3765199	0.35
Q12404	Protein disulfide-isomerase MPD1 (EC 5.3.4.1)	EBI-3765207	0.35
P32829	Double-strand break repair protein MRE11	EBI-3765223	0.35
Q06815	Mannose 6-phosphate receptor-like protein 1	EBI-3765231	0.35
P38175	37S ribosomal protein MRP21, mitochondrial (Mitochondrial small ribosomal subunit protein bS21m)	EBI-3765239	0.35
P36525	54S ribosomal protein L24, mitochondrial (Mitochondrial large ribosomal subunit protein bL28m) (YmL14/YmL24)	EBI-3765247	0.35
P36534	54S ribosomal protein L40, mitochondrial (Mitochondrial large ribosomal subunit protein uL24m) (YmL40)	EBI-3765255	0.35
P21771	37S ribosomal protein S28, mitochondrial (Mitochondrial small ribosomal subunit protein uS15m)	EBI-3765263	0.35
P48525	Glutamate--tRNA ligase, mitochondrial (EC 6.1.1.17) (Glutamyl-tRNA synthetase) (GluRS)	EBI-3765271	0.35
P25846	DNA mismatch repair protein MSH1, mitochondrial (MutS protein homolog 1)	EBI-3765279	0.53
Q03834	DNA mismatch repair protein MSH6 (MutS protein homolog 6) (Postmeiotic segregation protein 3)	EBI-3765287	0.35
P22438	Methionine--tRNA ligase, mitochondrial (EC 6.1.1.10) (Methionyl-tRNA synthetase) (MetRS)	EBI-3765303	0.35
P52918	Protein MSN5	EBI-3765312	0.35
P38714	Arginine--tRNA ligase, mitochondrial (EC 6.1.1.19) (Arginyl-tRNA synthetase) (ArgRS)	EBI-3765320	0.35
P38994	Phosphatidylinositol 4-phosphate 5-kinase MSS4 (EC 2.7.1.68) (1-phosphatidylinositol 4-phosphate kinase) (Diphosphoinositide kinase) (PIP5K)	EBI-3765328	0.35
Q03151	Mitochondrial GTPase 1	EBI-3765336	0.35
Q03920	eRF1 methyltransferase catalytic subunit MTQ2 (eRF1 MTase catalytic subunit MTQ2) (EC 2.1.1.297) (N(5)-glutamine methyltransferase MTQ2)	EBI-3765344	0.35
P40959	Sorting nexin MVP1	EBI-3765352	0.35
P08964	Myosin-1 (Type II myosin)	EBI-3765360	0.35
P36006	Myosin-3 (Actin-dependent myosin-I MYO3) (Class I unconventional myosin MYO3) (Type I myosin MYO3)	EBI-3765368	0.35
P27929	37S ribosomal protein NAM9, mitochondrial (Mitochondrial small ribosomal subunit protein uS4m) (Nuclear accommodation of mitochondria protein 9)	EBI-3765376	0.35
P25293	Nucleosome assembly protein	EBI-3765384	0.35
Q07500	External NADH-ubiquinone oxidoreductase 2, mitochondrial (EC 1.6.5.9) (External NADH dehydrogenase 2)	EBI-3765392	0.35
P40527	Probable phospholipid-transporting ATPase NEO1 (EC 7.6.2.1)	EBI-3765400	0.35
P32497	Eukaryotic translation initiation factor 3 subunit C (eIF3c) (Eukaryotic translation initiation factor 3 93 kDa subunit) (eIF3 p93) (Nuclear transport protein NIP1) (Translation initiation factor eIF3, p93 subunit)	EBI-3765408	0.35
P33420	Protein NIP100 (Protein NIP80)	EBI-3765416	0.35
P38798	Nonsense-mediated mRNA decay protein 2 (Up-frameshift suppressor 2)	EBI-3765424	0.35
Q99207	Nucleolar complex protein 14 (U three protein 2) (U3 small nucleolar RNA-associated protein 2) (U3 snoRNA-associated protein 2)	EBI-3765432	0.35
P39683	Nicotinate phosphoribosyltransferase (NAPRTase) (EC 6.3.4.21)	EBI-3765440	0.35
P43124	Non-structural maintenance of chromosome element 4 (Non-SMC element 4) (Protein QRI2)	EBI-3765448	0.35
Q00684	Tyrosine-protein phosphatase CDC14 (EC 3.1.3.48)	EBI-3765472	0.35
P50946	Putative tyrosine-protein phosphatase OCA1 (EC 3.1.3.48) (Oxidant-induced cell-cycle arrest protein 1)	EBI-3765480	0.35
P53397	N-glycosylase/DNA lyase [Includes: 8-oxoguanine DNA glycosylase (EC 3.2.2.-); DNA-(apurinic or apyrimidinic site) lyase (AP lyase) (EC 4.2.99.18)]	EBI-3765488	0.35
P16547	Mitochondrial outer membrane protein OM45 (Outer membrane protein of 45 kDa)	EBI-3765496	0.35
P21375	Fumarate reductase 2 (FRDS2) (EC 1.3.1.6) (NADH-dependent fumarate reductase) (Osmotic sensitivity protein 1) (Soluble fumarate reductase, mitochondrial isozyme)	EBI-3765504	0.35
P40512	Cop9 signalosome complex subunit 11 (Proteasome-COP9 signalosome-eIF3 domain protein 8)	EBI-3765512	0.35
P40186	PHO85 cyclin-7 (PHO85-associated protein 1)	EBI-3765520	0.35
Q12477	PHO85 cyclin-9	EBI-3765528	0.35
P06169	Pyruvate decarboxylase isozyme 1 (EC 4.1.1.-) (EC 4.1.1.43) (EC 4.1.1.72) (EC 4.1.1.74) (Thiamine pyrophosphate-dependent 2-oxo-acid decarboxylase) (2ODC)	EBI-3765536	0.35
P27801	Vacuolar membrane protein PEP3 (Carboxypeptidase Y-deficient protein 3) (Vacuolar morphogenesis protein 8) (Vacuolar protein sorting-associated protein 18) (Vacuolar protein-targeting protein 18)	EBI-3765544	0.35
P12868	E3 ubiquitin-protein ligase PEP5 (EC 2.3.2.27) (Carboxypeptidase Y-deficient protein 5) (Histone E3 ligase PEP5) (RING-type E3 ubiquitin transferase PEP5) (Vacuolar biogenesis protein END1) (Vacuolar morphogenesis protein 1) (Vacuolar protein sorting-associated protein 11) (Vacuolar protein-targeting protein 11)	EBI-3765552	0.35
P08468	Protein PET111, mitochondrial	EBI-3765560	0.35
P32606	Putative mitochondrial translation system component PET127	EBI-3765568	0.35
P53112	Peroxisomal membrane protein PEX14 (Peroxin-14)	EBI-3765576	0.35
P35056	Peroxisomal targeting signal receptor (PTS1 receptor) (PTS1R) (Peroxin-5) (Peroxisomal protein PAS10)	EBI-3765584	0.35
P53248	Peroxisomal biogenesis factor 8 (Peroxin-8) (Peroxisomal protein PAS6)	EBI-3765592	0.35
P40433	6-phosphofructo-2-kinase 1 (6PF-2-K 1) (EC 2.7.1.105) (Phosphofructokinase 2 I)	EBI-3765600	0.35
P36093	Putative transcription factor PHD1	EBI-3765608	0.35
Q12252	Phosphate metabolism protein 7	EBI-3765616	0.35
P19881	4-nitrophenylphosphatase (PNPPase) (EC 3.1.3.41)	EBI-3765624	0.35
P20052	PHO85 cyclin PHO80 (Aminoglycoside antibiotic sensitivity protein 3) (Phosphate system cyclin PHO80)	EBI-3765632	0.35
P38264	SRP-independent targeting protein 3 (Inorganic phosphate transport protein PHO88) (Phosphate metabolism protein PHO88)	EBI-3765640	0.35
P07271	ATP-dependent DNA helicase PIF1 (EC 3.6.4.12) (DNA repair and recombination helicase PIF1) (Petite integration frequency protein 1) (Telomere stability protein 1)	EBI-3765648	0.35
P24583	Protein kinase C-like 1 (PKC 1) (EC 2.7.11.13)	EBI-3765656	0.35
Q03306	Serine/threonine-protein kinase PKH3 (EC 2.7.11.1) (Pkb-activating kinase homolog 3)	EBI-3765664	0.35
P32634	Negative regulator of sporulation PMD1	EBI-3765672	0.35
P33775	Dolichyl-phosphate-mannose--protein mannosyltransferase 1 (EC 2.4.1.109)	EBI-3765680	0.35
P21951	DNA polymerase epsilon catalytic subunit A (EC 2.7.7.7) (3'-5' exodeoxyribonuclease) (EC 3.1.11.-) (DNA polymerase II subunit A)	EBI-3765688	0.35
P39008	Poly(A) ribonuclease POP2 (EC 3.1.13.4) (CCR4-associated factor 1)	EBI-3765696	0.35
P40478	Mitochondrial outer membrane protein porin 2 (Voltage-dependent anion-selective channel protein 2) (VDAC-2)	EBI-3765709	0.35
P27796	3-ketoacyl-CoA thiolase, peroxisomal (EC 2.3.1.16) (Acetyl-CoA acyltransferase) (Beta-ketothiolase) (Peroxisomal 3-oxoacyl-CoA thiolase)	EBI-3765717	0.35
P07272	Pyrimidine pathway regulatory protein 1	EBI-3765726	0.35
P09232	Cerevisin (EC 3.4.21.48) (Proteinase YSCB) (Vacuolar protease B) (PrB)	EBI-3765734	0.35
P21242	Probable proteasome subunit alpha type-7 (Macropain subunit C1) (Multicatalytic endopeptidase complex subunit C1) (Proteasome component C1) (Proteinase YSCE subunit 1)	EBI-3765742	0.35
P23638	Proteasome subunit alpha type-3 (Macropain subunit Y13) (Multicatalytic endopeptidase complex subunit Y13) (Proteasome component Y13) (Proteinase YSCE subunit 13)	EBI-3765750	0.35
P54885	Gamma-glutamyl phosphate reductase (GPR) (EC 1.2.1.41) (Glutamate-5-semialdehyde dehydrogenase) (GSA dehydrogenase) (Glutamyl-gamma-semialdehyde dehydrogenase)	EBI-3765758	0.35
P24384	Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP22 (EC 3.6.4.13)	EBI-3765766	0.35
P33334	Pre-mRNA-splicing factor 8	EBI-3765774	0.35
P31374	Serine/threonine-protein kinase PSK1 (EC 2.7.11.1) (PAS kinase 1)	EBI-3765790	0.35
Q08217	Serine/threonine-protein kinase PSK2 (EC 2.7.11.1) (PAS kinase 2)	EBI-3765798	0.35
P36082	Putative platinum sensitivity protein 1	EBI-3765806	0.35
P40164	Serine/threonine-protein phosphatase 4 regulatory subunit 3 (PP4R3)	EBI-3765814	0.35
Q04373	Pumilio homology domain family member 6	EBI-3765822	0.35
Q08647	Multisubstrate pseudouridine synthase 7 (EC 5.4.99.-) (EC 5.4.99.27) (RNA pseudouridylate synthase 7) (RNA-uridine isomerase 7) (tRNA pseudouridine(13) synthase)	EBI-3765830	0.35
P52489	Pyruvate kinase 2 (PK 2) (EC 2.7.1.40)	EBI-3765838	0.35
P40352	DNA repair and recombination protein RAD26 (EC 3.6.4.12) (ATP-dependent helicase RAD26)	EBI-3765846	0.35
P14736	DNA repair protein RAD4	EBI-3765854	0.35
P32849	DNA repair protein RAD5 (EC 3.6.4.-) (Radiation sensitivity protein 5) (Revertibility protein 2)	EBI-3765862	0.35
P12753	DNA repair protein RAD50 (EC 3.6.-.-) (153 kDa protein)	EBI-3765870	0.53
P53063	Decapping nuclease RAI1 (ScRai1) (EC 3.6.1.-) (NAD-capped RNA hydrolase RAI1) (DeNADding enzyme RAI1) (EC 3.6.1.-) (RAT1-interacting protein)	EBI-3765878	0.35
Q02792	5'-3' exoribonuclease 2 (EC 3.1.13.-) (Ribonucleic acid-trafficking protein 1) (p116)	EBI-3765886	0.35
P47104	Regulator of V-ATPase in vacuolar membrane protein 1 (Suppression of the onset of impotence protein 3)	EBI-3765894	0.35
P25332	Ribokinase (RK) (EC 2.7.1.15)	EBI-3765902	0.35
P39531	Recyclin-1	EBI-3765910	0.35
P12689	DNA repair protein REV1 (EC 2.7.7.-) (Reversionless protein 1)	EBI-3765918	0.35
P14284	DNA polymerase zeta catalytic subunit (EC 2.7.7.7) (Protein reversionless 3)	EBI-3765926	0.35
Q12090	RNA exonuclease 3 (EC 3.1.-.-)	EBI-3765934	0.35
P38629	Replication factor C subunit 3 (Replication factor C3) (Activator 1 40 kDa subunit)	EBI-3765942	0.35
Q06407	Rho-type GTPase-activating protein 2	EBI-3765950	0.35
P19263	Mediator of RNA polymerase II transcription subunit 14 (Glucose repression regulatory protein 1) (Mediator complex subunit 14)	EBI-3765959	0.35
P40395	Guanine nucleotide exchange factor subunit RIC1 (Protein RIC1) (Ribosome control protein 1) (Ric1p)	EBI-3765967	0.35
P29539	Telomere length regulator protein RIF1 (RAP1-interacting factor 1)	EBI-3765975	0.35
P32445	Single-stranded DNA-binding protein RIM1, mitochondrial (Mitochondrial ssDNA-binding protein)	EBI-3765983	0.35
P43565	Serine/threonine-protein kinase RIM15 (EC 2.7.11.1)	EBI-3765991	0.35
Q08562	ATP-dependent helicase ULS1 (EC 3.6.4.-) (Role in silencing protein 1) (Ubiquitin ligase for SUMO conjugates protein 1)	EBI-3765999	0.35
Q08961	Ribosomal lysine N-methyltransferase 1 (EC 2.1.1.-)	EBI-3766007	0.35
Q03942	Ribosomal lysine N-methyltransferase 2 (EC 2.1.1.-)	EBI-3766015	0.35
P53552	THO complex subunit 2 (Low dye-binding protein 5) (THO complex subunit RLR1) (Zinc-regulated gene 13 protein)	EBI-3766023	0.35
P39975	Sporulation protein RMD6 (Required for meiotic nuclear division protein 6)	EBI-3766031	0.35
P32611	54S ribosomal protein RML2, mitochondrial (L2) (Mitochondrial large ribosomal subunit protein uL2m)	EBI-3766039	0.35
Q04740	Ribonuclease H (RNase H) (EC 3.1.26.4)	EBI-3766047	0.35
P21672	Ribonucleoside-diphosphate reductase large chain 2 (EC 1.17.4.1) (Ribonucleotide reductase DNA damage-inducible regulatory subunit 2) (Ribonucleotide reductase R1 subunit 2) (Ribonucleotide reductase large subunit 2)	EBI-3766055	0.53
P49723	Ribonucleoside-diphosphate reductase small chain 2 (EC 1.17.4.1) (Ribonucleotide reductase R2 subunit 2) (Ribonucleotide reductase small subunit 2)	EBI-3766063	0.35
P51862	RHO1 GDP-GTP exchange protein 2	EBI-3766071	0.35
P08518	DNA-directed RNA polymerase II subunit RPB2 (RNA polymerase II subunit 2) (EC 2.7.7.6) (B150) (DNA-directed RNA polymerase II 140 kDa polypeptide)	EBI-3766079	0.35
P32910	DNA-directed RNA polymerase III subunit RPC6 (RNA polymerase III subunit C6) (C34) (DNA-directed RNA polymerase III 36 kDa polypeptide)	EBI-3766087	0.35
P36160	Ribosome biogenesis protein RPF2	EBI-3766095	0.35
P38249	Eukaryotic translation initiation factor 3 subunit A (eIF3a) (Eukaryotic translation initiation factor 3 110 kDa subunit homolog) (eIF3 p110) (Translation initiation factor eIF3, p110 subunit homolog)	EBI-3766103	0.35
P05748	60S ribosomal protein L15-A (L13) (Large ribosomal subunit protein eL15-A) (RP15R) (YL10) (YP18)	EBI-3766111	0.35
P54780	60S ribosomal protein L15-B (L13) (Large ribosomal subunit protein eL15-B) (RP15R) (YL10) (YP18)	EBI-3766119	0.35
P14126	60S ribosomal protein L3 (Large ribosomal subunit protein uL3) (Maintenance of killer protein 8) (RP1) (Trichodermin resistance protein) (YL1)	EBI-3766127	0.35
P49166	60S ribosomal protein L37-A (L43) (Large ribosomal subunit protein eL37-A) (YL35) (YP55)	EBI-3766135	0.35
P05739	60S ribosomal protein L6-B (L17) (Large ribosomal subunit protein eL6-B) (RP18) (YL16)	EBI-3766143	0.35
P05737	60S ribosomal protein L7-A (L6) (Large ribosomal subunit protein uL30-A) (RP11) (YL8)	EBI-3766151	0.35
Q12213	60S ribosomal protein L7-B (L6) (Large ribosomal subunit protein uL30-B) (RP11) (YL8)	EBI-3766159	0.35
P38764	26S proteasome regulatory subunit RPN1 (HMG-CoA reductase degradation protein 2) (Proteasome non-ATPase subunit 1)	EBI-3766167	0.35
P38886	26S proteasome regulatory subunit RPN10	EBI-3766175	0.35
P53196	26S proteasome regulatory subunit RPN14 (Proteasome non-ATPase subunit 14)	EBI-3766183	0.35
P04050	DNA-directed RNA polymerase II subunit RPB1 (RNA polymerase II subunit 1) (RNA polymerase II subunit B1) (EC 2.7.7.6) (DNA-directed RNA polymerase III largest subunit) (RNA polymerase II subunit B220)	EBI-3766191	0.35
P38786	Ribonuclease P/MRP protein subunit RPP1 (EC 3.1.26.5) (RNA-processing protein RPP1) (RNaseP/MRP 32.2 kDa subunit)	EBI-3766199	0.35
P35271	40S ribosomal protein S18-A (Small ribosomal subunit protein uS13-A)	EBI-3766207	0.35
P33442	40S ribosomal protein S1-A (RP10A) (Small ribosomal subunit protein eS1-A)	EBI-3766215	0.35
P38701	40S ribosomal protein S20 (Small ribosomal subunit protein uS10)	EBI-3766223	0.35
P26786	40S ribosomal protein S7-A (RP30) (RP40) (Small ribosomal subunit protein eS7-A)	EBI-3766232	0.35
P53549	26S proteasome subunit RPT4 (26S protease subunit SUG2) (Proteasomal cap subunit)	EBI-3766240	0.35
P33297	26S proteasome regulatory subunit 6A (Tat-binding protein homolog 1) (TBP-1)	EBI-3766248	0.35
Q01939	26S proteasome regulatory subunit 8 homolog (Protein CIM3) (Protein SUG1) (Tat-binding protein TBY1)	EBI-3766256	0.35
Q12348	COP9 signalosome complex subunit 10	EBI-3766264	0.35
P25359	Exosome complex component RRP43 (Ribosomal RNA-processing protein 43)	EBI-3766272	0.35
Q05022	rRNA biogenesis protein RRP5 (Ribosomal RNA-processing protein 5) (U3 small nucleolar RNA-associated protein RRP5) (U3 snoRNA-associated protein RRP5)	EBI-3766280	0.35
Q02206	Chromatin structure-remodeling complex subunit RSC4 (RSC complex subunit RSC4) (Remodel the structure of chromatin complex subunit 4)	EBI-3766288	0.35
P13856	Ras-related protein RSR1 (EC 3.6.5.2)	EBI-3766296	0.35
P38903	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit delta isoform (PP2A, B subunit, B' delta isoform) (Protein RTS1) (Protein SCS1)	EBI-3766304	0.35
P40962	Zinc finger protein RTS2	EBI-3766312	0.35
P53289	Protein phosphatase type 2A regulatory subunit RTS3	EBI-3766320	0.35
P10659	S-adenosylmethionine synthase 1 (AdoMet synthase 1) (EC 2.5.1.6) (Methionine adenosyltransferase 1) (MAT 1)	EBI-3766336	0.35
P50110	Sorting assembly machinery 37 kDa subunit (MAS37 protein) (Mitochondrial 37 kDa outer membrane protein)	EBI-3766344	0.35
P53036	SIT4-associating protein SAP4	EBI-3766352	0.35
P53324	Steryl acetyl hydrolase 1 (EC 3.1.1.-)	EBI-3766360	0.35
Q04002	Sister chromatid cohesion protein 2	EBI-3766368	0.35
Q12334	Protein SCM3 (Suppressor of chromosome missegregation protein 3)	EBI-3766376	0.35
P38072	Protein SCO2, mitochondrial	EBI-3766384	0.35
P48415	COPII coat assembly protein SEC16 (Protein transport protein SEC16)	EBI-3766392	0.35
P18759	Vesicular-fusion protein SEC18	EBI-3766400	0.35
P32844	Exocyst complex component SEC6	EBI-3766408	0.35
P32855	Exocyst complex component SEC8	EBI-3766416	0.35
Q04228	UBX domain-containing protein 2 (Secretion lowering protein 1)	EBI-3766424	0.35
Q00416	Helicase SEN1 (EC 3.6.4.-) (tRNA-splicing endonuclease positive effector)	EBI-3766432	0.35
P33330	Phosphoserine aminotransferase (PSAT) (EC 2.6.1.52) (Phosphohydroxythreonine aminotransferase)	EBI-3766440	0.35
P36124	SET domain-containing protein 3	EBI-3766448	0.35
Q12369	Protein SFI1 (Suppressor of fermentation induced loss of stress resistance protein 1)	EBI-3766456	0.35
P34223	UBX domain-containing protein 1 (Suppressor of high-copy PP1 protein)	EBI-3766472	0.35
Q07657	Seventh homolog of septin 1 (Septation protein 7)	EBI-3766480	0.35
P53266	Cytochrome oxidase assembly protein SHY1 (SURF1 homolog of Yeast) (SURF1-like protein)	EBI-3766488	0.35
Q12460	Nucleolar protein 56 (Ribosome biosynthesis protein SIK1) (Suppressor of I kappa b protein 1)	EBI-3766496	0.35
P22579	Transcriptional regulatory protein SIN3	EBI-3766504	0.35
P53965	Inositol phosphatase SIW14 (EC 3.6.1.52) (5-PP-InsP phosphatase) (Inositol pyrophosphate phosphatase SIW14) (Oxidant-induced cell-cycle arrest protein 3) (Synthetic interaction with WHI2 protein 14)	EBI-3766512	0.35
Q06315	Protein SKG3 (Suppressor of lethality of KEX2-GAS1 double null mutant protein 3)	EBI-3766520	0.35
P35207	Antiviral helicase SKI2 (EC 3.6.4.13) (Superkiller protein 2)	EBI-3766528	0.35
P42843	F-box protein SKP2	EBI-3766536	0.35
Q02775	Pre-mRNA-splicing factor SLU7 (Synthetic lethal with U2 snRNA protein 17) (Synthetic lethal with U5 snRNA protein 7)	EBI-3766544	0.35
P32908	Structural maintenance of chromosomes protein 1 (DA-box protein SMC1)	EBI-3766552	0.35
P12904	5'-AMP-activated protein kinase subunit gamma (AMPK gamma) (AMPK subunit gamma) (Regulatory protein CAT3) (Sucrose non-fermenting protein 4)	EBI-3766568	0.35
P32568	Protein SNQ2	EBI-3766576	0.35
P25357	Probable DNA-binding protein SNT1 (SANT domain-containing protein 1)	EBI-3766584	0.35
P53127	E3 ubiquitin-protein ligase SNT2 (EC 2.3.2.27) (Histone E3 ligase SNT2) (RING-type E3 ubiquitin transferase SNT2) (SANT domain-containing protein 2)	EBI-3766592	0.35
Q04748	Protein SOV1, mitochondrial	EBI-3766600	0.35
P23201	Protein SPA2	EBI-3766608	0.35
P25808	ATP-dependent rRNA helicase SPB4 (EC 3.6.4.13) (Suppressor of PAB1 protein 4)	EBI-3766616	0.35
P32380	Spindle pole body component 110 (Extragenic suppressor of CMD1-1 mutant protein 1) (Nuclear filament-related protein 1) (Spindle pole body spacer protein SPC110)	EBI-3766624	0.35
P36126	Phospholipase D1 (PLD 1) (EC 3.1.4.4) (Choline phosphatase 1) (Meiosis-specific sporulation-specific protein 14) (Phosphatidylcholine-hydrolyzing phospholipase D1)	EBI-3766632	0.35
Q03868	Prospore membrane adapter protein SPO71 (Sporulation-specific protein 71)	EBI-3766640	0.35
Q03012	COMPASS component SPP1 (Complex proteins associated with SET1 protein SPP1) (Set1C component SPP1) (Suppressor of PRP protein 1)	EBI-3766648	0.35
P08458	Sporulation-specific protein 1 (EC 2.7.11.1)	EBI-3766656	0.53
P32558	FACT complex subunit SPT16 (Cell division control protein 68) (Facilitates chromatin transcription complex subunit SPT16) (Suppressor of Ty protein 16)	EBI-3766664	0.35
Q12020	Protein SRL2 (Suppressor of RAD53 null lethality protein 2)	EBI-3766680	0.35
P38688	Signal recognition particle subunit SRP72 (Signal recognition particle 72 kDa protein homolog)	EBI-3766688	0.35
P53599	MAP kinase kinase kinase SSK2 (EC 2.7.11.25) (Suppressor of sensor kinase 2)	EBI-3766696	0.53
P47821	RNA polymerase II holoenzyme cyclin-like subunit (Suppressor of RNA polymerase B 11)	EBI-3766704	0.35
P11972	Protein SST2	EBI-3766712	0.35
P46679	Protein STB2	EBI-3766720	0.35
P18851	Guanine nucleotide-binding protein subunit beta	EBI-3766728	0.53
P32597	Nuclear protein STH1/NPS1 (EC 3.6.4.12) (ATP-dependent helicase STH1) (Chromatin structure-remodeling complex protein STH1) (SNF2 homolog)	EBI-3766736	0.35
P53101	Cystathionine beta-lyase (CBL) (EC 4.4.1.13) (Beta-cystathionase) (Cysteine lyase) (Cysteine-S-conjugate beta-lyase) (Sulfur transfer protein 3)	EBI-3766744	0.35
P37297	Phosphatidylinositol 4-kinase STT4 (PI4-kinase) (PtdIns-4-kinase) (EC 2.7.1.67)	EBI-3766752	0.35
P38198	Protein STU1 (Suppressor of tubulin 1)	EBI-3766760	0.35
P09064	Eukaryotic translation initiation factor 2 subunit beta (eIF-2-beta)	EBI-3766768	0.35
P46676	Suppressor of mar1-1 protein (SUM1-1 protein)	EBI-3766776	0.35
P12385	Eukaryotic peptide chain release factor subunit 1 (Eukaryotic release factor 1) (eRF1) (Omnipotent suppressor protein 1)	EBI-3766784	0.35
P31376	SWR1-complex protein 3	EBI-3766792	0.35
P08153	Transcriptional factor SWI5	EBI-3766800	0.35
P40528	Protein SYG1	EBI-3766808	0.35
P40468	Cell morphogenesis protein PAG1 (Protein TAO3)	EBI-3766816	0.35
Q06510	Tafazzin (Taz) (EC 2.3.1.-)	EBI-3766824	0.35
Q12466	Tricalbin-1	EBI-3766832	0.35
Q03640	Tricalbin-3	EBI-3766840	0.35
P38228	Mitochondrial chaperone TCM62	EBI-3766848	0.35
P00359	Glyceraldehyde-3-phosphate dehydrogenase 3 (GAPDH 3) (EC 1.2.1.12)	EBI-3766856	0.35
P02994	Elongation factor 1-alpha (EF-1-alpha) (Eukaryotic elongation factor 1A) (eEF1A) (Translation elongation factor 1A)	EBI-3766864	0.35
P41903	Peroxisomal acyl-coenzyme A thioester hydrolase 1 (EC 3.1.2.2) (Peroxisomal long-chain acyl-CoA thioesterase 1)	EBI-3766872	0.35
P36145	Transcription initiation factor IIE subunit beta (TFIIE-beta) (Factor A 43 kDa subunit) (Transcription factor A small subunit)	EBI-3766880	0.35
Q02939	General transcription and DNA repair factor IIH subunit TFB2 (TFIIH subunit TFB2) (RNA polymerase II transcription factor B 52 kDa subunit) (RNA polymerase II transcription factor B p52 subunit) (RNA polymerase II transcription factor B subunit 2)	EBI-3766888	0.35
P32367	Transcription factor tau 95 kDa subunit (TFIIIC 95 kDa subunit) (Transcription factor C subunit 1)	EBI-3766896	0.35
P14306	Carboxypeptidase Y inhibitor (CPY inhibitor) (CDC25 suppressor 1) (I(C)) (Ic) (Protein DKA1) (Protein NSP1)	EBI-3766904	0.35
P10081	ATP-dependent RNA helicase eIF4A (EC 3.6.4.13) (Eukaryotic initiation factor 4A) (eIF-4A) (Stimulator factor I 37 kDa component) (Translation initiation factor 1/2) (p37)	EBI-3766912	0.35
P34167	Eukaryotic translation initiation factor 4B (eIF-4B)	EBI-3766920	0.35
P40217	Eukaryotic translation initiation factor 3 subunit I (eIF3i) (Eukaryotic translation initiation factor 3 39 kDa subunit) (eIF-3 39 kDa subunit) (eIF3 p39)	EBI-3766928	0.35
Q04067	Eukaryotic translation initiation factor 3 subunit G (eIF3g) (Eukaryotic translation initiation factor 3 RNA-binding subunit) (eIF-3 RNA-binding subunit) (Translation initiation factor eIF3 p33 subunit) (eIF3 p33)	EBI-3766936	0.35
P38431	Eukaryotic translation initiation factor 5 (eIF-5)	EBI-3766944	0.35
Q01852	Mitochondrial import inner membrane translocase subunit TIM44 (Inner membrane import site protein 45) (ISP45) (Membrane import machinery protein MIM44) (Mitochondrial protein import protein 1)	EBI-3766952	0.35
Q02208	Topoisomerase 1-associated factor 2	EBI-3766960	0.35
P35169	Serine/threonine-protein kinase TOR1 (EC 2.7.11.1) (Dominant rapamycin resistance protein 1) (Phosphatidylinositol kinase homolog TOR1) (Target of rapamycin kinase 1)	EBI-3766976	0.35
P40032	Prolyl 3,4-dihydroxylase TPA1 (EC 1.14.11.-) (Termination and polyadenylation protein 1) (uS12 prolyl 3,4-dihydroxylase)	EBI-3766984	0.35
P40414	Tropomyosin-2	EBI-3766992	0.35
P48561	Poly(A) RNA polymerase protein 1 (EC 2.7.7.19) (Topoisomerase 1-related protein TRF5)	EBI-3767000	0.35
P12685	High-affinity potassium transport protein	EBI-3767008	0.35
Q04183	Trafficking protein particle complex II-specific subunit 120 (TRAPP II-specific subunit 120) (Transport protein particle 120 kDa subunit)	EBI-3767016	0.35
P40061	Target of rapamycin complex 2 subunit TSC11 (TORC2 subunit TSC11) (Adheres voraciously to TOR2 protein 3) (Temperature-sensitive CSG2 suppressor protein 11)	EBI-3767024	0.35
P09733	Tubulin alpha-1 chain (EC 3.6.5.-)	EBI-3767032	0.35
P09734	Tubulin alpha-3 chain (EC 3.6.5.-)	EBI-3767040	0.35
P52488	Ubiquitin-activating enzyme E1-like (Polymerase-interacting protein 2) (SMT3-activating enzyme subunit 2)	EBI-3767048	0.35
P25037	Ubiquitin carboxyl-terminal hydrolase 1 (EC 3.4.19.12) (Deubiquitinating enzyme 1) (Ubiquitin thioesterase 1) (Ubiquitin-specific-processing protease 1)	EBI-3767056	0.35
Q06682	UBX domain-containing protein 5	EBI-3767064	0.35
P07259	Protein URA2 [Includes: Glutamine-dependent carbamoyl-phosphate synthase (EC 6.3.5.5); Aspartate carbamoyltransferase (EC 2.1.3.2)]	EBI-3767072	0.35
P03962	Orotidine 5'-phosphate decarboxylase (EC 4.1.1.23) (OMP decarboxylase) (OMPDCase) (OMPdecase) (Uridine 5'-monophosphate synthase) (UMP synthase)	EBI-3767080	0.35
P25386	Intracellular protein transport protein USO1 (Int-1)	EBI-3767088	0.35
P35194	U3 small nucleolar RNA-associated protein 20 (U3 snoRNA-associated protein 20) (U three protein 20)	EBI-3767096	0.35
P53254	U3 small nucleolar RNA-associated protein 22 (U3 snoRNA-associated protein 22) (U three protein 22)	EBI-3767104	0.35
Q06679	U3 small nucleolar RNA-associated protein 4 (U3 snoRNA-associated protein 4) (U three protein 4) (U3 protein 4 required for transcription) (t-UTP4)	EBI-3767112	0.35
Q07468	Vacuolar morphogenesis protein 6 (Vacuolar protein sorting-associated protein 39)	EBI-3767120	0.35
P40522	Transcription factor VHR1 (VHT1 regulator 1)	EBI-3767128	0.35
Q06337	Chromatin modification-related protein EAF1 (ESA1-associated factor 1) (Vacuolar import and degradation protein 21)	EBI-3767136	0.35
P40157	Vacuolar import and degradation protein 27	EBI-3767144	0.35
P40547	Vacuolar import and degradation protein 28 (Glucose-induced degradation protein 5)	EBI-3767152	0.35
P16140	V-type proton ATPase subunit B (V-ATPase subunit B) (V-ATPase 57 kDa subunit) (Vacuolar proton pump subunit B)	EBI-3767160	0.35
P23643	Vacuolar protein sorting-associated protein 3 (Vacuolar protein-targeting protein 17)	EBI-3767168	0.35
Q03433	Vacuolar protein sorting-associated protein 71 (SWR complex protein 6)	EBI-3767176	0.35
P40438	VPS10 homolog 1 (Sortilin VTH1)	EBI-3767184	0.35
P40890	VPS10 homolog 2 (Sortilin VTH2)	EBI-3767192	0.35
P33767	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit WBP1 (Oligosaccharyl transferase subunit WBP1) (Oligosaccharyl transferase subunit beta)	EBI-3767200	0.35
Q12416	G1-specific transcriptional repressor WHI5	EBI-3767208	0.35
P38749	AP-1-like transcription factor YAP3	EBI-3767216	0.35
O13527	Truncated transposon Ty1-A Gag-Pol polyprotein (TY1B) (Transposon Ty1 TYB polyprotein) [Cleaved into: Integrase (IN) (Pol-p71) (p84) (p90); Reverse transcriptase/ribonuclease H (RT) (RT-RH) (EC 2.7.7.49) (EC 2.7.7.7) (EC 3.1.26.4) (Pol-p63) (p60)]	EBI-3767224	0.35
P40017	Carnitine O-acetyltransferase YAT2 (EC 2.3.1.7)	EBI-3767232	0.35
P34220	Deoxyribonuclease Tat-D (EC 3.1.21.-)	EBI-3767240	0.35
P34225	Guanine-nucleotide exchange factor YEL1 (EFA6-like protein 1)	EBI-3767248	0.35
Q12491	Transposon Ty2-B Gag-Pol polyprotein (TY2A-TY2B) (Transposon Ty2 TYA-TYB polyprotein) [Cleaved into: Capsid protein (CA); Ty2 protease (PR) (EC 3.4.23.-); Integrase (IN); Reverse transcriptase/ribonuclease H (RT) (RT-RH) (EC 2.7.7.49) (EC 2.7.7.7) (EC 3.1.26.4)]	EBI-3767256	0.35
Q12193	Transposon Ty1-BR Gag-Pol polyprotein (Gag-Pol-p199) (TY1A-TY1B) (Transposon Ty1 TYA-TYB polyprotein) (p190) [Cleaved into: Capsid protein (CA) (Gag-p45) (p54); Ty1 protease (PR) (EC 3.4.23.-) (Pol-p20) (p23); Integrase (IN) (Pol-p71) (p84) (p90); Reverse transcriptase/ribonuclease H (RT) (RT-RH) (EC 2.7.7.49) (EC 2.7.7.7) (EC 3.1.26.4) (Pol-p63) (p60)]	EBI-3767271	0.35
P38219	Obg-like ATPase 1	EBI-3767279	0.35
P38266	Altered inheritance of mitochondria protein 3	EBI-3767287	0.35
P38331	5'-deoxynucleotidase YBR242W (EC 3.1.3.89)	EBI-3767295	0.35
P38332	Diphthine methyltransferase (EC 3.1.1.97) (Diphthamide biosynthesis protein 7) (Endosomal recycling protein 1) (Regulator of rDNA transcription protein 2)	EBI-3767303	0.35
P39109	Metal resistance protein YCF1 (ABC-type Cd(2+) transporter) (EC 7.2.2.2) (ABC-type glutathione-S-conjugate transporter) (EC 7.6.2.3) (Yeast cadmium factor 1)	EBI-3767311	0.35
P25616	Cold tolerance protein 1	EBI-3767319	0.35
Q06156	Condensin complex subunit 1 (XCAP-D2 homolog)	EBI-3767327	0.35
Q07349	MIOREX complex component 9 (Mitochondrial organization of gene expression protein 9)	EBI-3767335	0.35
Q12516	Regulator of phospholipase D SRF1 (SPO14 regulatory factor 1)	EBI-3767343	0.35
Q06640	F-box protein YDR306C	EBI-3767351	0.35
Q04411	Uracil catabolism protein 2	EBI-3767359	0.35
P89887	Putative uncharacterized protein YEL076C-A	EBI-3767367	0.35
Q3E7X8	Y' element ATP-dependent helicase YEL077C (EC 3.6.4.12)	EBI-3767379	0.35
P40028	Holliday junction resolvase YEN1 (EC 3.1.-.-)	EBI-3767387	0.35
P40085	Endoplasmic reticulum membrane protein 65 (65 kDa endoplasmic reticulum membrane protein)	EBI-3767395	0.35
P43560	Membrane-anchored lipid-binding protein LAM5 (Lipid transfer at contact site protein 2) (Lipid transfer protein anchored at membrane contact sites 1)	EBI-3767403	0.35
P43597	Uncharacterized protein YFR016C	EBI-3767411	0.35
P53144	5'-deoxynucleotidase YGK1 (EC 3.1.3.89)	EBI-3767419	0.35
P53100	Putative 2-hydroxyacid dehydrogenase YGL185C (EC 1.-.-.-)	EBI-3767427	0.35
P53077	Maintenance of telomere capping protein 3, mitochondrial	EBI-3767435	0.35
P53234	Uncharacterized protein YGR053C	EBI-3767443	0.35
P53246	Late endosome and vacuole interface protein 11	EBI-3767451	0.35
Q99315	Transposon Ty3-G Gag-Pol polyprotein (Gag3-Pol3) (Transposon Ty3-1 TYA-TYB polyprotein) [Cleaved into: Capsid protein (CA) (p24); Spacer peptide p3; Nucleocapsid protein p11 (NC); Ty3 protease (PR) (EC 3.4.23.-) (p16); Spacer peptide J; Reverse transcriptase/ribonuclease H (RT) (RT-RH) (EC 2.7.7.49) (EC 2.7.7.7) (EC 3.1.26.4) (p55); Integrase p61 (IN); Integrase p58 (IN)]	EBI-3767459	0.35
P50089	Uncharacterized protein YGR237C	EBI-3767474	0.35
P53321	Putative uncharacterized protein YGR259C	EBI-3767482	0.35
Q05900	U1 small nuclear ribonucleoprotein C (U1 snRNP C) (U1-C) (U1C)	EBI-3767490	0.35
P0C2J7	Transposon Ty4-H Gag-Pol polyprotein (TY4A-TY4B) (Transposon Ty4 TYA-TYB polyprotein) [Includes: Capsid protein (CA); Ty4 protease (PR) (EC 3.4.23.-); Integrase (IN); Reverse transcriptase/ribonuclease H (RT) (RT-RH) (EC 2.7.7.49) (EC 2.7.7.7) (EC 3.1.26.4)]	EBI-3767498	0.35
P38842	UPF0641 membrane protein YHR140W	EBI-3767506	0.35
P47024	Transposon Ty4-J Gag-Pol polyprotein (TY4A-TY4B) (Transposon Ty4 TYA-TYB polyprotein) [Includes: Capsid protein (CA); Ty4 protease (PR) (EC 3.4.23.-); Integrase (IN); Reverse transcriptase/ribonuclease H (RT) (RT-RH) (EC 2.7.7.49) (EC 2.7.7.7) (EC 3.1.26.4)]	EBI-3767514	0.35
P47101	UPF0508 protein YJR030C	EBI-3767522	0.35
P28320	Splicing factor YJU2	EBI-3767530	0.35
P34246	Maintenance of telomere capping protein 2	EBI-3767538	0.35
P34248	Probable intramembrane protease YKL100C (EC 3.4.23.-)	EBI-3767546	0.35
P28273	5-oxoprolinase (EC 3.5.2.9) (5-oxo-L-prolinase) (5-OPase) (Pyroglutamase)	EBI-3767554	0.35
P36158	Uncharacterized protein YKR078W	EBI-3767562	0.35
Q07799	ELMO family protein LMO1	EBI-3767570	0.35
Q12244	Uncharacterized transcriptional regulatory protein YLL054C	EBI-3767578	0.35
Q12177	Uncharacterized protein YLL056C	EBI-3767586	0.35
Q07897	Protein CMS1 (Complementation of MCM10 suppressor protein 1)	EBI-3767594	0.35
Q12110	Uncharacterized protein YLR049C	EBI-3767602	0.35
Q12288	Putative glutamine amidotransferase YLR126C (EC 2.4.2.-)	EBI-3767610	0.35
Q06247	Putative uncharacterized protein YLR173W	EBI-3767622	0.35
Q06152	Uncharacterized protein YLR271W	EBI-3767630	0.35
Q05867	Uncharacterized protein YLR283W, mitochondrial	EBI-3767638	0.35
Q06159	Autophagy-related protein 39	EBI-3767646	0.35
Q06479	F-box protein YLR352W	EBI-3767654	0.35
Q06409	DOCK-like protein 1	EBI-3767662	0.35
O13577	Damage-regulated import facilitator 1	EBI-3767670	0.35
Q04533	Putative cystathionine gamma-synthase YML082W (EC 2.5.1.48) (O-succinylhomoserine (thiol)-lyase)	EBI-3767678	0.35
Q04371	Damage-control phosphatase YMR027W (EC 3.1.3.-) (Sugar phosphate phosphatase YMR027W)	EBI-3767686	0.35
P0CF18	Uncharacterized protein YMR085W	EBI-3767694	0.35
Q03153	ATPase synthesis protein 25, mitochondrial (OLI1 mRNA stabilization factor)	EBI-3767709	0.35
Q04471	Abasic site processing protein YMR114C (EC 3.4.-.-)	EBI-3767717	0.35
Q03496	tRNA (cytidine(32)-2'-O)-methyltransferase non-catalytic subunit TRM732	EBI-3767725	0.35
P40168	Uncharacterized protein YNL195C	EBI-3767733	0.35
P53850	Restriction of telomere capping protein 4	EBI-3767753	0.35
P53837	Putative uncharacterized protein YNL276C	EBI-3767765	0.35
P53756	ABC transporter ATP-binding protein/permease PDR18 (Pleiotropic drug resistance protein 18)	EBI-3767773	0.35
P53757	Uncharacterized isomerase YNR071C (EC 5.-.-.-)	EBI-3767781	0.35
Q99247	DUB-associated factor 1	EBI-3767789	0.53
Q12496	Uncharacterized protein YOL098C	EBI-3767797	0.35
Q08270	Uncharacterized protein YOL131W	EBI-3767805	0.35
Q08457	Mitochondrial morphogenesis protein SLD7 (Synthetic lethality with DPB11-24 mutation protein 7)	EBI-3767813	0.35
Q12275	Uncharacterized protein YOR093C	EBI-3767821	0.35
P53049	Oligomycin resistance ATP-dependent permease YOR1 (ABC transporter YOR1) (ABC-type Cd(2+) transporter) (EC 7.2.2.2) (ABC-type glutathione-S-conjugate transporter) (EC 7.6.2.3) (Yeast oligomycin resistance protein 1)	EBI-3767829	0.35
Q12032	Altered inheritance of mitochondria protein 41, mitochondrial	EBI-3767837	0.35
Q08748	Uncharacterized protein YOR296W	EBI-3767845	0.35
Q02754	Uncharacterized protein YPL067C	EBI-3767853	0.35
Q02895	Putative aryl-alcohol dehydrogenase AAD16 (EC 1.1.1.-)	EBI-3767861	0.35
Q08964	Putative ISWI chromatin-remodeling complex subunit YPL216W	EBI-3767869	0.35
Q06813	Uncharacterized protein YPR078C	EBI-3767877	0.35
Q06108	Regulator of the glycerol channel 1	EBI-3767885	0.35
P01123	GTP-binding protein YPT1 (Protein YP2) (Rab GTPase YPT1) (Transport GTPase YPT1)	EBI-3767893	0.35
P51996	GTP-binding protein YPT32/YPT11 (Rab GTPase YPT32)	EBI-3767901	0.35
P36019	GTP-binding protein YPT53	EBI-3767909	0.35
Q12159	RNA annealing protein YRA1	EBI-3767917	0.35
P53819	Y' element ATP-dependent helicase protein 1 copy 6 (EC 3.6.4.12)	EBI-3767925	0.35
P40341	Mitochondrial respiratory chain complexes assembly protein YTA12 (EC 3.4.24.-) (Tat-binding homolog 12)	EBI-3767933	0.35
P40328	Probable 26S proteasome subunit YTA6 (Tat-binding homolog 6)	EBI-3767941	0.35
P40340	ATPase histone chaperone YTA7 (EC 3.6.1.-) (ATPase family AAA domain-containing protein YTA7) (AAA-ATPase) (Tat-binding homolog 7)	EBI-3767949	0.35
P31111	Synaptonemal complex protein ZIP1	EBI-3767957	0.35
P22202	Heat shock protein SSA4	EBI-3767965	0.35
A0A023PZA9	Putative uncharacterized protein YDR230W	EBI-3862867	0.35
P22146	1,3-beta-glucanosyltransferase GAS1 (EC 2.4.1.-) (Glycolipid-anchored surface protein 1) (Glycoprotein GP115)	EBI-6900105	0.27
P04150	Glucocorticoid receptor (GR) (Nuclear receptor subfamily 3 group C member 1)	EBI-9819201	0.50
P25367	[PIN+] prion protein RNQ1 (Rich in asparagine and glutamine protein 1)	EBI-15790589	0.44
Q08601	Metacaspase-1 (EC 3.4.22.-) [Cleaved into: Large subunit p20; Small subunit p10]	EBI-15865212	0.35
Q12004	General transcription and DNA repair factor IIH subunit TFB4 (TFIIH subunit TFB4) (RNA polymerase II transcription factor B 34 kDa subunit) (RNA polymerase II transcription factor B p34 subunit) (RNA polymerase II transcription factor B subunit 4)	EBI-15942387	0.35
Q00776	AP-1 complex subunit mu-1-I (Clathrin assembly protein complex 1 mu-1-I medium chain) (Clathrin coat assembly protein AP54) (Clathrin coat-associated protein AP54) (Golgi adaptor AP-1 54 kDa protein) (HA1 54 kDa subunit) (Mu(1)-adaptin) (Mu1-I-adaptin)	EBI-16263794	0.35
P38153	AP-3 complex subunit mu (AP-3 adaptor complex mu3A subunit) (Adaptor-related protein complex 3 subunit mu) (Mu-adaptin 3A) (Mu3-adaptin)	EBI-16263895	0.35
P32381	Actin-related protein 2 (Actin-like protein ARP2) (Actin-like protein 2)	EBI-16264169	0.35
P26448	Mitotic check point protein BUB2 (Cell cycle arrest protein BUB2)	EBI-16264549	0.35
P53323	EKC/KEOPS complex subunit BUD32 (EC 3.6.-.-) (Atypical serine/threonine protein kinase BUD32) (EC 2.7.11.1) (Bud site selection protein 32) (Low-dye-binding protein 14) (piD261)	EBI-16264767	0.35
P00546	Cyclin-dependent kinase 1 (CDK1) (EC 2.7.11.22) (Cell division control protein 28) (Cell division protein kinase 1)	EBI-16265841	0.35
P25656	Cell division control protein 50	EBI-16266167	0.35
Q00362	Protein phosphatase PP2A regulatory subunit B (Cell division control protein 55) (PR55)	EBI-16266261	0.35
P06243	Cell division control protein 7 (EC 2.7.11.1)	EBI-16266350	0.35
P04819	DNA ligase 1 (EC 6.5.1.1) (DNA ligase I) (Polydeoxyribonucleotide synthase [ATP] 1)	EBI-16266449	0.35
P38147	Serine/threonine-protein kinase CHK1 (EC 2.7.11.1) (Checkpoint kinase 1)	EBI-16266584	0.35
Q01649	Spindle pole body-associated protein CIK1 (Chromosome instability and karyogamy protein 1)	EBI-16266663	0.35
P24869	G2/mitotic-specific cyclin-2	EBI-16266949	0.35
P41735	5-demethoxyubiquinone hydroxylase, mitochondrial (DMQ hydroxylase) (EC 1.14.99.60) (Catabolite repression protein 5) (Ubiquinone biosynthesis monooxygenase COQ7)	EBI-16267444	0.35
P47027	DNA replication regulator DPB11	EBI-16268315	0.35
P17214	Telomere elongation protein EST1 (Ever shorter telomeres protein 1)	EBI-16268957	0.35
P32502	Translation initiation factor eIF-2B subunit beta (GCD complex subunit GCD7) (Guanine nucleotide exchange factor subunit GCD7) (eIF-2B GDP-GTP exchange factor subunit beta)	EBI-16269661	0.35
P32598	Serine/threonine-protein phosphatase PP1-2 (EC 3.1.3.16)	EBI-16270070	0.35
P06774	Transcriptional activator HAP2	EBI-16270452	0.35
P13434	Transcriptional activator HAP3 (UAS2 regulatory protein A)	EBI-16270569	0.35
Q99181	Protein HSH49	EBI-16271249	0.35
P32464	Protein HYM1	EBI-16271424	0.35
P32581	Meiosis induction protein kinase IME2/SME1 (EC 2.7.11.1)	EBI-16271455	0.35
P13902	Protein INO4	EBI-16271541	0.35
P14681	Mitogen-activated protein kinase KSS1 (MAP kinase KSS1) (EC 2.7.11.24) (Kinase suppressor of SST2)	EBI-16272210	0.35
Q12446	Proline-rich protein LAS17	EBI-16272438	0.35
Q02574	DNA damage checkpoint control protein MEC3	EBI-16273337	0.35
P39014	F-box protein MET30 (E3 ubiquitin ligase complex SCF(Met30) subunit MET30) (Methionine-requiring protein 30)	EBI-16273553	0.35
P26188	Methylated-DNA--protein-cysteine methyltransferase (EC 2.1.1.63) (6-O-methylguanine-DNA methyltransferase) (MGMT) (DNA repair MTase) (O-6-methylguanine-DNA-alkyltransferase)	EBI-16273684	0.35
P32491	MAP kinase kinase MKK2/SSP33 (EC 2.7.12.2)	EBI-16273903	0.35
Q04149	Crossover junction endonuclease MUS81 (EC 3.1.22.-) (MMS and UV-sensitive protein 81)	EBI-16274423	0.35
Q02931	NET1-associated nuclear protein 1 (U three protein 17) (t-17) (U3 protein 17 required for transcription) (U3 small nucleolar RNA-associated protein 17) (U3 snoRNA-associated protein 17)	EBI-16274579	0.35
P40354	Protein N-terminal amidase (NT-amidase) (EC 3.5.1.-)	EBI-16274812	0.35
P39108	Peroxisomal targeting signal 2 receptor (PTS2 receptor) (Peroxin-7) (Peroxisome import protein PAS7)	EBI-16275488	0.35
P16862	ATP-dependent 6-phosphofructokinase subunit beta (EC 2.7.1.11) (ATP-dependent 6-phosphofructokinase) (ATP-PFK) (Phosphofructokinase 2) (Phosphohexokinase)	EBI-16275628	0.35
P25615	DNA polymerase IV (POL IV) (EC 2.7.7.7)	EBI-16276002	0.35
P23594	Serine/threonine-protein phosphatase PP2A-1 catalytic subunit (EC 3.1.3.16)	EBI-16276062	0.35
P30620	DNA cross-link repair protein PSO2/SNM1 (EC 3.1.-.-)	EBI-16276917	0.35
P34221	Protein phosphatase 2C homolog 3 (PP2C-3) (EC 3.1.3.16)	EBI-16277075	0.35
P25635	Periodic tryptophan protein 2 (U three protein 1) (U3 small nucleolar RNA-associated protein 1) (U3 snoRNA-associated protein 1)	EBI-16277306	0.35
Q04049	DNA polymerase eta (EC 2.7.7.7) (Radiation-sensitive protein 30)	EBI-16278245	0.35
Q12223	DNA repair protein RAD59	EBI-16278713	0.35
P40348	Replication factor C subunit 2 (Replication factor C2) (Activator 1 41 kDa subunit)	EBI-16279429	0.35
Q12300	High glucose sensor RGT2 (Low-affinity glucose receptor RGT2) (Low-affinity transporter-like sensor RGT2) (Restores glucose transport protein 2)	EBI-16279741	0.35
Q12749	Structural maintenance of chromosomes protein 6 (DNA repair protein RHC18) (Rad18 homolog)	EBI-16279839	0.35
P05317	60S acidic ribosomal protein P0 (A0) (L10e) (Large ribosomal subunit protein uL10)	EBI-16280656	0.35
P33298	26S proteasome regulatory subunit 6B homolog (Protein YNT1) (Tat-binding homolog 2)	EBI-16280713	0.35
P41811	Coatomer subunit beta' (Beta'-coat protein) (Beta'-COP)	EBI-16281700	0.35
P38262	SIR4-interacting protein SIF2	EBI-16282437	0.35
P32259	Mediator of RNA polymerase II transcription subunit 16 (Global transcriptional regulator SIN4) (Mediator complex subunit 16) (SNF1 suppressor protein 4) (SWI4 suppressor protein 5) (Transcriptional silencing factor 3) (YGP1 expression regulatory protein 1)	EBI-16282486	0.35
P34164	SNF1 protein kinase subunit beta-2 (Protein SPM2) (SNF1-interacting protein 2)	EBI-16282515	0.35
P06701	Regulatory protein SIR3 (Silent information regulator 3)	EBI-16282584	0.35
P20604	Serine/threonine-protein phosphatase PP1-1 (EC 3.1.3.16)	EBI-16282774	0.35
Q00772	Mitogen-activated protein kinase SLT2/MPK1 (MAP kinase MPK1) (EC 2.7.11.24)	EBI-16283115	0.35
P41808	Sporulation-specific mitogen-activated protein kinase SMK1 (MAP kinase SMK1) (EC 2.7.11.24)	EBI-16283296	0.35
Q00916	U1 small nuclear ribonucleoprotein 70 kDa homolog (U1 70K) (U1 snRNP 70 kDa homolog) (U1-70K) (U1 small nuclear ribonucleoprotein SNP1) (U1 snRNP protein SNP1)	EBI-16283579	0.35
Q12379	Anaphase-promoting complex subunit SWM1 (Anaphase-promoting complex subunit 13) (Spore wall maturation protein 1)	EBI-16284692	0.35
P38987	Protein TEM1	EBI-16285008	0.35
P53916	Probable phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TEP1 (EC 3.1.3.67)	EBI-16285181	0.35
P53632	Poly(A) RNA polymerase protein 2 (EC 2.7.7.19) (DNA polymerase kappa) (DNA polymerase sigma) (Topoisomerase 1-related protein TRF4)	EBI-16285647	0.35
P52490	Ubiquitin-conjugating enzyme E2 13 (EC 2.3.2.23) (E2 ubiquitin-conjugating enzyme 13) (Ubiquitin carrier protein 13) (Ubiquitin-protein ligase 13)	EBI-16285898	0.35
P14680	Dual specificity protein kinase YAK1 (EC 2.7.12.1)	EBI-16286565	0.35
P38191	Protein yippee-like MOH1	EBI-16286723	0.35
P38319	Tyrosyl-DNA phosphodiesterase 1 (Tyr-DNA phosphodiesterase 1) (EC 3.1.4.-)	EBI-16286900	0.35
Q03899	F-box protein YDR131C	EBI-16287816	0.35
Q03944	Vacuolar protein sorting-associated protein 64 (Factor arrest protein 9)	EBI-16287890	0.35
Q05498	rRNA-processing protein FCF1 (FAF1-copurifying factor 1)	EBI-16288251	0.35
P87263	Putative uncharacterized protein YER066C-A	EBI-16288516	0.35
P53156	Uncharacterized protein YGL081W	EBI-16288834	0.35
P53295	Ribosome-interacting GTPase 2 (GTP-binding protein RBG2)	EBI-16289121	0.35
P36005	Serine/threonine-protein kinase KDX1 (EC 2.7.11.1) (Kinase dead X-talker protein 1) (MPK1-like protein kinase 1)	EBI-16290101	0.35
P32807	ATP-dependent DNA helicase II subunit 1 (EC 3.6.4.12) (ATP-dependent DNA helicase II subunit Ku70) (High affinity DNA-binding factor subunit 1)	EBI-16290244	0.35
Q04437	ATP-dependent DNA helicase II subunit 2 (EC 3.6.4.12) (ATP-dependent DNA helicase II subunit Ku80) (High affinity DNA-binding factor subunit 2) (Yeast Ku80)	EBI-16290301	0.35
P53877	Pre-rRNA-processing protein IPI3 (Involved in processing IST2 protein 3)	EBI-16291922	0.35
Q12152	Putative serine/threonine-protein kinase YPL150W (EC 2.7.11.1)	EBI-16292374	0.35
P0CE41	Heme-responsive zinc finger transcription factor HAP1 (CYP1 activatory protein) (Heme activator protein 1)	EBI-16401531	0.35

Cross-References

Database	Links
UNIPROT	P25491 D6W1B6
PDB	1NLT 1XAO 5VSO
Pfam	PF00226 PF01556 PF00684
PROSITE	PS00636 PS50076 PS51188

Mitochondrial protein import protein MAS5 (Saccharomyces cerevisiae S288C)

General Information

Protein Information

Structure Viewer (PDB: 1XAO)

Subcellular Location

Description Show

Position in the Nuclear Envelope

Membrane Topology

Assigned Ontology terms

Biology & Function

Description Hide

Assigned Ontology terms

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (20 interactors)

Interactions with other proteins (881 interactors)

Cross-References

Database

Links

Description

Description