Clusterin alpha chain - Homo sapiens

Clusterin alpha chain (Homo sapiens)

FASTA TEXT XML

Subcellular Location Biology & Function Interactions Cross-References

General Information

Protein Information
Protein Name	Clusterin alpha chain
Accession Code	P10909
Gene	CLU
Organism	Homo sapiens \| Human (Taxonomy: 9606)
Part of Reference Proteome?	Yes
Sequence (Length: 449)
MMKTLLLFVGLLLTWESGQVLGDQTVSDNELQEMSNQGSKYVNKEIQNAVNGVKQIKTLIEKTNEERKTLLSNLEEAKKKKEDALNETRESETKLKELPGVCNETMMALWEECKPCLKQTCMKFYARVCR SGSGLVGRQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQTHMLDVMQDHFSRASSIIDELFQDRFFTREPQDTYHYLPFSLPHRRPHFFFPKSRIVRSLMPFSPYEPLNFHAMFQPFLEMIHEAQQAMDI HFHSPAFQHPPTEFIREGDDDRTVCREIRHNSTGCLRMKDQCDKCREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLRVTTVA SHTSDSDVPSGVTEVVVKLFDSDPITVTVPVEVSRKNPKFMETVAEKALQEYRKKHREE

Subcellular Location

Description
[Isoform 1]: Secreted {Experimental EvidencePubMed:11123922, Experimental EvidencePubMed:17260971, Experimental EvidencePubMed:17412999, Experimental EvidencePubMed:17451556, Experimental EvidencePubMed:2387851, Experimental EvidencePubMed:24073260, Experimental EvidencePubMed:2780565, Experimental EvidencePubMed:3154963, Experimental EvidencePubMed:8292612, Experimental EvidencePubMed:8328966}. Note=Can retrotranslocate from the secretory compartments to the cytosol upon cellular stress. {Experimental EvidencePubMed:17451556}. [Isoform 4]: Cytoplasm {Experimental EvidencePubMed:24073260}. Note=Keeps cytoplasmic localization in stressed and unstressed cell. {Experimental EvidencePubMed:24073260}. [Isoform 6]: Cytoplasm {Experimental EvidencePubMed:24073260}. Note=Keeps cytoplasmic localization in stressed and unstressed cell. {Experimental EvidencePubMed:24073260}. Nucleus {Experimental EvidencePubMed:12551933, Experimental EvidencePubMed:19137541}. Cytoplasm {Experimental EvidencePubMed:12551933, ECO:0000269\|PubMed:17689225, Experimental EvidencePubMed:19137541, ECO:0000269\|PubMed:20068069, ECO:0000269\|PubMed:22689054, Experimental EvidencePubMed:24073260}. Mitochondrion membrane; Peripheral membrane protein; Cytoplasmic side {ECO:0000269\|PubMed:17689225}. Cytoplasm, cytosol {Experimental EvidencePubMed:17451556, ECO:0000269\|PubMed:22689054, Experimental EvidencePubMed:24073260}. Microsome {ECO:0000269\|PubMed:22689054}. Endoplasmic reticulum {ECO:0000269\|PubMed:16113678, ECO:0000269\|PubMed:22689054}. Mitochondrion {ECO:0000269\|PubMed:16113678, ECO:0000269\|PubMed:22689054}. Mitochondrion membrane {ECO:0000269\|PubMed:16113678, ECO:0000269\|PubMed:17689225}. Cytoplasm, perinuclear region {ECO:0000250\|UniProtKB:P05371}. Cytoplasmic vesicle, secretory vesicle, chromaffin granule {ECO:0000250}. Note=Secreted isoforms can retrotranslocate from the secretory compartments to the cytosol upon cellular stress (PubMed:17451556). Detected in perinuclear foci that may be aggresomes containing misfolded, ubiquitinated proteins (PubMed:20068069). Detected at the mitochondrion membrane upon induction of apoptosis (PubMed:17689225). Under ER stress, a immaturely glycosylated pre-secreted form retrotranslocates from the endoplasmic reticulum (ER)-Golgi network to the cytoplasm to localize in the mitochondria through HSPA5 interaction (PubMed:22689054). ER stress reduces secretion (PubMed:22689054). Under the stress, minor amounts of non-secreted forms accumulate in cytoplasm (PubMed:24073260, PubMed:22689054, PubMed:17451556). Non-secreted forms emerge mainly from failed translocation, alternative splicing or non-canonical initiation start codon (PubMed:24073260, PubMed:12551933). {Experimental EvidencePubMed:12551933, Experimental EvidencePubMed:17451556, ECO:0000269\|PubMed:17689225, ECO:0000269\|PubMed:20068069, ECO:0000269\|PubMed:22689054, Experimental EvidencePubMed:24073260}.
Position in the Nuclear Envelope
Location	Location ID	Description
Perinuclear Region	SL-0198	The perinuclear region is the cytoplasmic region just around the nucleus.
Membrane Topology
Topology	Source	Annotation Type
Peripheral	UniProt	Sequence Analysis
Assigned Ontology terms

Cellular Component	Apical Dendrite (GO:0097440) Blood Microparticle (GO:0072562) Cell Surface (GO:0009986) Chromaffin Granule (GO:0042583) Collagen-Containing Extracellular Matrix (GO:0062023) Cytoplasm (GO:0005737) Cytosol (GO:0005829) Extracellular Exosome (GO:0070062) Extracellular Region (GO:0005576) Extracellular Space (GO:0005615) Golgi Apparatus (GO:0005794) Intracellular Membrane-Bounded Organelle (GO:0043231) Mitochondrial Inner Membrane (GO:0005743) Mitochondrion (GO:0005739) Neurofibrillary Tangle (GO:0097418) Nucleus (GO:0005634) Perinuclear Endoplasmic Reticulum Lumen (GO:0099020) Perinuclear Region Of Cytoplasm (GO:0048471) Platelet Alpha Granule Lumen (GO:0031093) Protein-Containing Complex (GO:0032991) Spherical High-Density Lipoprotein Particle (GO:0034366) Synapse (GO:0045202)

Biology & Function

Description
[Isoform 1]: Functions as extracellular chaperone that prevents aggregation of non native proteins (PubMed:11123922, PubMed:19535339). Prevents stress-induced aggregation of blood plasma proteins (PubMed:11123922, PubMed:12176985, PubMed:17260971, PubMed:19996109). Inhibits formation of amyloid fibrils by APP, APOC2, B2M, CALCA, CSN3, SNCA and aggregation-prone LYZ variants (in vitro) (PubMed:12047389, PubMed:17412999, PubMed:17407782). Does not require ATP (PubMed:11123922). Maintains partially unfolded proteins in a state appropriate for subsequent refolding by other chaperones, such as HSPA8/HSC70 (PubMed:11123922). Does not refold proteins by itself (PubMed:11123922). Binding to cell surface receptors triggers internalization of the chaperone-client complex and subsequent lysosomal or proteasomal degradation (PubMed:21505792). Protects cells against apoptosis and against cytolysis by complement (PubMed:2780565). Intracellular forms interact with ubiquitin and SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complexes and promote the ubiquitination and subsequent proteasomal degradation of target proteins (PubMed:20068069). Promotes proteasomal degradation of COMMD1 and IKBKB (PubMed:20068069). Modulates NF-kappa-B transcriptional activity (PubMed:12882985). A mitochondrial form suppresses BAX- dependent release of cytochrome c into the cytoplasm and inhibit apoptosis (PubMed:16113678, PubMed:17689225). Plays a role in the regulation of cell proliferation (PubMed:19137541). An intracellular form suppresses stress-induced apoptosis by stabilizing mitochondrial membrane integrity through interaction with HSPA5 (PubMed:22689054). Secreted form does not affect caspase or BAX-mediated intrinsic apoptosis and TNF-induced NF-kappa-B-activity (PubMed:24073260). Secreted form act as an important modulator during neuronal differentiation through interaction with STMN3 (By similarity). Plays a role in the clearance of immune complexes that arise during cell injury (By similarity). {By SimilarityUniProtKB:P05371, By SimilarityUniProtKB:Q06890, Experimental EvidencePubMed:11123922, Experimental EvidencePubMed:12047389, Experimental EvidencePubMed:12176985, Experimental EvidencePubMed:12882985, Experimental EvidencePubMed:16113678, Experimental EvidencePubMed:17260971, Experimental EvidencePubMed:17407782, Experimental EvidencePubMed:17412999, Experimental EvidencePubMed:17689225, Experimental EvidencePubMed:19137541, Experimental EvidencePubMed:19535339, Experimental EvidencePubMed:19996109, Experimental EvidencePubMed:20068069, Experimental EvidencePubMed:21505792, Experimental EvidencePubMed:22689054, Experimental EvidencePubMed:24073260, Experimental EvidencePubMed:2780565}. [Isoform 6]: Does not affect caspase or BAX-mediated intrinsic apoptosis and TNF-induced NF-kappa-B-activity. {Experimental EvidencePubMed:24073260}. [Isoform 4]: Does not affect caspase or BAX-mediated intrinsic apoptosis and TNF-induced NF-kappa-B-activity (PubMed:24073260). Promotes cell death through interaction with BCL2L1 that releases and activates BAX (PubMed:21567405). {ECO:0000269\|PubMed:21567405, Experimental EvidencePubMed:24073260}.
Assigned Ontology terms

Biological Process	Cell Morphogenesis (GO:0000902) Central Nervous System Myelin Maintenance (GO:0032286) Chaperone-Mediated Protein Complex Assembly (GO:0051131) Chaperone-Mediated Protein Folding (GO:0061077) Complement Activation (GO:0006956) Complement Activation, Classical Pathway (GO:0006958) Immune Complex Clearance (GO:0002434) Innate Immune Response (GO:0045087) Intrinsic Apoptotic Signaling Pathway (GO:0097193) Lipid Metabolic Process (GO:0006629) Microglial Cell Activation (GO:0001774) Microglial Cell Proliferation (GO:0061518) Negative Regulation Of Amyloid Fibril Formation (GO:1905907) Negative Regulation Of Amyloid-Beta Formation (GO:1902430) Negative Regulation Of Cell Death (GO:0060548) Obsolete Negative Regulation Of Cellular Response To Thapsigargin (GO:1905892) Obsolete Negative Regulation Of Cellular Response To Tunicamycin (GO:1905895) Negative Regulation Of Intrinsic Apoptotic Signaling Pathway In Response To DNA Damage (GO:1902230) Negative Regulation Of Protein-Containing Complex Assembly (GO:0031333) Negative Regulation Of Release Of Cytochrome C From Mitochondria (GO:0090201) Negative Regulation Of Response To Endoplasmic Reticulum Stress (GO:1903573) Positive Regulation Of Amyloid Fibril Formation (GO:1905908) Positive Regulation Of Amyloid-Beta Formation (GO:1902004) Positive Regulation Of Apoptotic Process (GO:0043065) Positive Regulation Of Gene Expression (GO:0010628) Positive Regulation Of Intrinsic Apoptotic Signaling Pathway (GO:2001244) Positive Regulation Of Neurofibrillary Tangle Assembly (GO:1902998) Positive Regulation Of Neuron Death (GO:1901216) Positive Regulation Of NF-KappaB Transcription Factor Activity (GO:0051092) Positive Regulation Of Nitric Oxide Biosynthetic Process (GO:0045429) Positive Regulation Of Proteasomal Ubiquitin-Dependent Protein Catabolic Process (GO:0032436) Positive Regulation Of Protein-Containing Complex Assembly (GO:0031334) Positive Regulation Of Receptor-Mediated Endocytosis (GO:0048260) Positive Regulation Of Tau-Protein Kinase Activity (GO:1902949) Positive Regulation Of Tumor Necrosis Factor Production (GO:0032760) Positive Regulation Of Ubiquitin-Dependent Protein Catabolic Process (GO:2000060) Protein Import (GO:0017038) Protein Stabilization (GO:0050821) Protein Targeting To Lysosome Involved In Chaperone-Mediated Autophagy (GO:0061740) Regulation Of Amyloid-Beta Clearance (GO:1900221) Regulation Of Apoptotic Process (GO:0042981) Regulation Of Cell Population Proliferation (GO:0042127) Regulation Of Neuron Death (GO:1901214) Regulation Of Neuronal Signal Transduction (GO:1902847) Release Of Cytochrome C From Mitochondria (GO:0001836) Response To Misfolded Protein (GO:0051788) Response To Virus (GO:0009615) Reverse Cholesterol Transport (GO:0043691)
Molecular Function	Amyloid-Beta Binding (GO:0001540) Chaperone Binding (GO:0051087) Low-Density Lipoprotein Particle Receptor Binding (GO:0050750) Misfolded Protein Binding (GO:0051787) Protein Carrier Chaperone (GO:0140597) Protein Heterodimerization Activity (GO:0046982) Protein-Containing Complex Binding (GO:0044877) Signaling Receptor Binding (GO:0005102) Tau Protein Binding (GO:0048156) Ubiquitin Protein Ligase Binding (GO:0031625) Unfolded Protein Binding (GO:0051082)

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (12 interactors)

Partner (NucEnvDB)		IntAct	Confidence score
O14656	Torsin-1A	EBI-21693789	0.35
Q96HP0	Dedicator of cytokinesis protein 6	EBI-11117520	0.35
Q6P9B9	Integrator complex subunit 5	EBI-21693789	0.35
P62879	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2	EBI-21693789	0.35
Q96QG7	Myotubularin-related protein 9	EBI-21831285	0.35
Q06787	Fragile X messenger ribonucleoprotein 1	EBI-21371844	0.00
P10909	Self	EBI-21371813	0.00
Q9Z0X1	Apoptosis-inducing factor 1, mitochondrial	EBI-11065573	0.35
Q07817	Bcl-2-like protein 1	EBI-4322676	0.61
Q9Y6D5	Brefeldin A-inhibited guanine nucleotide-exchange protein 2	EBI-21370252	0.00
Q9BWU1	Cyclin-dependent kinase 19	EBI-6381327	0.35
Q9DB34	Charged multivesicular body protein 2a	EBI-11115096	0.35
Interactions with other proteins (155 interactors)

Partner (UniProt)		IntAct	Confidence score
Q9NRI5	Disrupted in schizophrenia 1 protein	EBI-1105564	0.00
Q9UKE5	TRAF2 and NCK-interacting protein kinase (EC 2.7.11.1)	EBI-1105584	0.00
P30101	Protein disulfide-isomerase A3 (EC 5.3.4.1) (58 kDa glucose-regulated protein) (58 kDa microsomal protein) (p58) (Disulfide isomerase ER-60) (Endoplasmic reticulum resident protein 57) (ER protein 57) (ERp57) (Endoplasmic reticulum resident protein 60) (ER protein 60) (ERp60)	EBI-7172377	0.59
P02647	Apolipoprotein A-I (Apo-AI) (ApoA-I) (Apolipoprotein A1) [Cleaved into: Proapolipoprotein A-I (ProapoA-I); Truncated apolipoprotein A-I (Apolipoprotein A-I(1-242))]	EBI-1220621	0.35
P01876	Immunoglobulin heavy constant alpha 1 (Ig alpha-1 chain C region) (Ig alpha-1 chain C region BUR) (Ig alpha-1 chain C region TRO)	EBI-1221175	0.35
P01857	Immunoglobulin heavy constant gamma 1 (Ig gamma-1 chain C region) (Ig gamma-1 chain C region EU) (Ig gamma-1 chain C region KOL) (Ig gamma-1 chain C region NIE)	EBI-1222317	0.35
P62993	Growth factor receptor-bound protein 2 (Adapter protein GRB2) (Protein Ash) (SH2/SH3 adapter GRB2)	EBI-2115936	0.00
O35638	Cohesin subunit SA-2 (SCC3 homolog 2) (Stromal antigen 2)	EBI-2559549	0.40
P16104	Histone H2AX (H2a/x) (Histone H2A.X)	EBI-2564373	0.35
P22736	Nuclear receptor subfamily 4 group A member 1 (Early response protein NAK1) (Nuclear hormone receptor NUR/77) (Nur77) (Orphan nuclear receptor HMR) (Orphan nuclear receptor TR3) (ST-59) (Testicular receptor 3)	EBI-2681480	0.00
P01100	Protein c-Fos (Cellular oncogene fos) (Fos proto-oncogene, AP-1 transcription factor subunit) (G0/G1 switch regulatory protein 7) (Proto-oncogene c-Fos) (Transcription factor AP-1 subunit c-Fos)	EBI-2694247	0.52
Q00987	E3 ubiquitin-protein ligase Mdm2 (EC 2.3.2.27) (Double minute 2 protein) (Hdm2) (Oncoprotein Mdm2) (RING-type E3 ubiquitin transferase Mdm2) (p53-binding protein Mdm2)	EBI-2682977	0.00
P04150	Glucocorticoid receptor (GR) (Nuclear receptor subfamily 3 group C member 1)	EBI-2684198	0.00
P37231	Peroxisome proliferator-activated receptor gamma (PPAR-gamma) (Nuclear receptor subfamily 1 group C member 3)	EBI-2793955	0.52
P17028	Zinc finger protein 24 (Retinoic acid suppression protein A) (RSG-A) (Zinc finger and SCAN domain-containing protein 3) (Zinc finger protein 191) (Zinc finger protein KOX17)	EBI-2691450	0.00
A0A6L7HEE9	RNA polymerase sigma factor SigA	EBI-2836046	0.00
P02866	Concanavalin-A (Con A)	EBI-2906001	0.35
O15160	DNA-directed RNA polymerases I and III subunit RPAC1 (DNA-directed RNA polymerase I subunit C) (RNA polymerases I and III subunit AC1) (AC40) (DNA-directed RNA polymerases I and III 40 kDa polypeptide) (RPA40) (RPA39) (RPC40)	EBI-3907424	0.37
P05181	Cytochrome P450 2E1 (EC 1.14.14.1) (4-nitrophenol 2-hydroxylase) (EC 1.14.13.n7) (CYPIIE1) (Cytochrome P450-J)	EBI-3907394	0.37
Q99708	DNA endonuclease RBBP8 (EC 3.1.-.-) (CtBP-interacting protein) (CtIP) (Retinoblastoma-binding protein 8) (RBBP-8) (Retinoblastoma-interacting protein and myosin-like) (RIM) (Sporulation in the absence of SPO11 protein 2 homolog) (SAE2)	EBI-3907404	0.37
O14901	Krueppel-like factor 11 (Transforming growth factor-beta-inducible early growth response protein 2) (TGFB-inducible early growth response protein 2) (TIEG-2)	EBI-3907414	0.37
Q14145	Kelch-like ECH-associated protein 1 (Cytosolic inhibitor of Nrf2) (INrf2) (Kelch-like protein 19)	EBI-3907434	0.37
Q9Y3Q8	TSC22 domain family protein 4 (TSC22-related-inducible leucine zipper protein 2) (Tsc-22-like protein THG-1)	EBI-3916122	0.37
P45984	Mitogen-activated protein kinase 9 (MAP kinase 9) (MAPK 9) (EC 2.7.11.24) (JNK-55) (Stress-activated protein kinase 1a) (SAPK1a) (Stress-activated protein kinase JNK2) (c-Jun N-terminal kinase 2)	EBI-3927894	0.37
P62829	60S ribosomal protein L23 (60S ribosomal protein L17) (Large ribosomal subunit protein uL14)	EBI-3927914	0.37
P46379	Large proline-rich protein BAG6 (BAG family molecular chaperone regulator 6) (BCL2-associated athanogene 6) (BAG-6) (HLA-B-associated transcript 3) (Protein G3) (Protein Scythe)	EBI-3927904	0.37
P18509	Pituitary adenylate cyclase-activating polypeptide (PACAP) [Cleaved into: PACAP-related peptide (PRP-48); Pituitary adenylate cyclase-activating polypeptide 27 (PACAP-27) (PACAP27); Pituitary adenylate cyclase-activating polypeptide 38 (PACAP-38) (PACAP38)]	EBI-10129061	0.54
P06460	Probable protein E5A	EBI-11723082	0.35
P06792	Probable protein E5	EBI-11724527	0.35
P0C739	Protein BNLF2a	EBI-11725101	0.35
P0CK56	Uncharacterized protein BDLF4	EBI-11725466	0.35
P69901	Probable protein E5B	EBI-11733364	0.35
Q8AZK7	Epstein-Barr nuclear antigen leader protein (EBNA-LP) (EBV nuclear antigen leader protein) (Epstein-Barr nuclear antigen 5) (EBNA-5) (EBV nuclear antigen 5)	EBI-11734159	0.35
Q6P5D4	Centrosomal protein of 135 kDa (Cep135) (Centrosomal protein 4)	EBI-10991106	0.35
A2APR8	Mitotic checkpoint serine/threonine-protein kinase BUB1	EBI-11001201	0.35
P14625	Endoplasmin (94 kDa glucose-regulated protein) (GRP-94) (Heat shock protein 90 kDa beta member 1) (Tumor rejection antigen 1) (gp96 homolog)	EBI-11044830	0.35
Q9D3R3	Centrosomal protein of 72 kDa (Cep72)	EBI-11075393	0.35
Q6ZQ29	Serine/threonine-protein kinase TAO2 (EC 2.7.11.1) (Thousand and one amino acid protein 2)	EBI-11075869	0.35
Q6NXE6	Armadillo repeat-containing protein 6	EBI-11080193	0.35
Q96RT8	Gamma-tubulin complex component 5 (GCP-5)	EBI-11083232	0.35
P51114	RNA-binding protein FXR1 (FMR1 autosomal homolog 1) (hFXR1p)	EBI-11117520	0.35
Q7Z333	Probable helicase senataxin (EC 3.6.4.-) (Amyotrophic lateral sclerosis 4 protein) (SEN1 homolog) (Senataxin)	EBI-11117520	0.35
Q5VW52	Glycerol-3-phosphate acyltransferase 1, mitochondrial (EC 2.3.1.15)	EBI-11117520	0.35
P27824	Calnexin (IP90) (Major histocompatibility complex class I antigen-binding protein p88) (p90)	EBI-11117520	0.35
P16234	Platelet-derived growth factor receptor alpha (PDGF-R-alpha) (PDGFR-alpha) (EC 2.7.10.1) (Alpha platelet-derived growth factor receptor) (Alpha-type platelet-derived growth factor receptor) (CD140 antigen-like family member A) (CD140a antigen) (Platelet-derived growth factor alpha receptor) (Platelet-derived growth factor receptor 2) (PDGFR-2) (CD antigen CD140a)	EBI-11134723	0.35
P03428	Polymerase basic protein 2 (RNA-directed RNA polymerase subunit P3)	EBI-12580574	0.35
Q6IQ23	Pleckstrin homology domain-containing family A member 7 (PH domain-containing family A member 7)	EBI-16398399	0.35
P20036	HLA class II histocompatibility antigen, DP alpha 1 chain (DP(W3)) (DP(W4)) (HLA-SB alpha chain) (MHC class II DP3-alpha) (MHC class II DPA1)	EBI-21511890	0.35
Q01814	Plasma membrane calcium-transporting ATPase 2 (PMCA2) (EC 7.2.2.10) (Plasma membrane calcium ATPase isoform 2) (Plasma membrane calcium pump isoform 2)	EBI-21599092	0.35
Q9H8H2	Probable ATP-dependent RNA helicase DDX31 (EC 3.6.4.13) (DEAD box protein 31) (Helicain)	EBI-21616235	0.35
Q8NI29	F-box only protein 27 (F-box/G-domain protein 5)	EBI-21693789	0.35
Q9UHG3	Prenylcysteine oxidase 1 (EC 1.8.3.5) (Prenylcysteine lyase)	EBI-21693789	0.35
Q9UBQ6	Exostosin-like 2 (EC 2.4.1.223) (Alpha-1,4-N-acetylhexosaminyltransferase EXTL2) (Alpha-GalNAcT EXTL2) (EXT-related protein 2) (Glucuronyl-galactosyl-proteoglycan 4-alpha-N-acetylglucosaminyltransferase) [Cleaved into: Processed exostosin-like 2]	EBI-21693789	0.35
Q9P273	Teneurin-3 (Ten-3) (Protein Odd Oz/ten-m homolog 3) (Tenascin-M3) (Ten-m3) (Teneurin transmembrane protein 3)	EBI-21693789	0.35
Q9NYQ6	Cadherin EGF LAG seven-pass G-type receptor 1 (Cadherin family member 9) (Flamingo homolog 2) (hFmi2)	EBI-21693789	0.35
Q9NX40	OCIA domain-containing protein 1 (Ovarian cancer immunoreactive antigen domain containing 1) (Ovarian carcinoma immunoreactive antigen)	EBI-21693789	0.35
Q9H0V9	VIP36-like protein (Lectin mannose-binding 2-like) (LMAN2-like protein)	EBI-21693789	0.35
Q9BV94	ER degradation-enhancing alpha-mannosidase-like protein 2	EBI-21693789	0.35
Q8NFZ4	Neuroligin-2	EBI-21693789	0.35
Q8NBM8	Prenylcysteine oxidase-like (EC 1.8.3.-)	EBI-21693789	0.35
Q6V0I7	Protocadherin Fat 4 (hFat4) (Cadherin family member 14) (FAT tumor suppressor homolog 4) (Fat-like cadherin protein FAT-J)	EBI-21693789	0.35
Q6PKC3	Thioredoxin domain-containing protein 11 (EF-hand-binding protein 1)	EBI-21693789	0.35
Q5SRI9	Glycoprotein endo-alpha-1,2-mannosidase (Endo-alpha mannosidase) (Endomannosidase) (hEndo) (EC 3.2.1.130) (Mandaselin)	EBI-21693789	0.35
Q5JTY5	Zinc-regulated GTPase metalloprotein activator 1C (EC 3.6.5.-) (Cobalamin synthase W domain-containing protein 3) (COBW domain-containing protein 3)	EBI-21693789	0.35
Q58EX2	Protein sidekick-2	EBI-21693789	0.35
Q13332	Receptor-type tyrosine-protein phosphatase S (R-PTP-S) (EC 3.1.3.48) (Receptor-type tyrosine-protein phosphatase sigma) (R-PTP-sigma)	EBI-21693789	0.35
P53708	Integrin alpha-8 [Cleaved into: Integrin alpha-8 heavy chain; Integrin alpha-8 light chain]	EBI-21693789	0.35
P41273	Tumor necrosis factor ligand superfamily member 9 (4-1BB ligand) (4-1BBL)	EBI-21693789	0.35
P33908	Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA (EC 3.2.1.113) (Man(9)-alpha-mannosidase) (Man9-mannosidase) (Mannosidase alpha class 1A member 1) (Processing alpha-1,2-mannosidase IA) (Alpha-1,2-mannosidase IA)	EBI-21693789	0.35
P10586	Receptor-type tyrosine-protein phosphatase F (EC 3.1.3.48) (Leukocyte common antigen related) (LAR)	EBI-21693789	0.35
O60476	Mannosyl-oligosaccharide 1,2-alpha-mannosidase IB (EC 3.2.1.113) (Mannosidase alpha class 1A member 2) (Processing alpha-1,2-mannosidase IB) (Alpha-1,2-mannosidase IB)	EBI-21693789	0.35
Q6ZRI8	Rho GTPase-activating protein 36	EBI-21744920	0.35
O15063	Granule associated Rac and RHOG effector protein 1 (GARRE1)	EBI-21830964	0.35
Q6P158	Putative ATP-dependent RNA helicase DHX57 (EC 3.6.4.13) (DEAH box protein 57)	EBI-21831097	0.35
Q96AT9	Ribulose-phosphate 3-epimerase (EC 5.1.3.1) (Ribulose-5-phosphate-3-epimerase)	EBI-21831245	0.35
P05067	Amyloid-beta precursor protein (APP) (ABPP) (APPI) (Alzheimer disease amyloid A4 protein homolog) (Alzheimer disease amyloid protein) (Amyloid precursor protein) (Amyloid-beta (A4) precursor protein) (Amyloid-beta A4 protein) (Cerebral vascular amyloid peptide) (CVAP) (PreA4) (Protease nexin-II) (PN-II) [Cleaved into: N-APP; Soluble APP-alpha (S-APP-alpha); Soluble APP-beta (S-APP-beta); C99 (Beta-secretase C-terminal fragment) (Beta-CTF); Amyloid-beta protein 42 (Abeta42) (Beta-APP42); Amyloid-beta protein 40 (Abeta40) (Beta-APP40); C83 (Alpha-secretase C-terminal fragment) (Alpha-CTF); P3(42); P3(40); C80; Gamma-secretase C-terminal fragment 59 (Amyloid intracellular domain 59) (AICD-59) (AID(59)) (Gamma-CTF(59)); Gamma-secretase C-terminal fragment 57 (Amyloid intracellular domain 57) (AICD-57) (AID(57)) (Gamma-CTF(57)); Gamma-secretase C-terminal fragment 50 (Amyloid intracellular domain 50) (AICD-50) (AID(50)) (Gamma-CTF(50)); C31]	EBI-15960333	0.68
Q9H4B6	Protein salvador homolog 1 (45 kDa WW domain protein) (hWW45)	EBI-16425156	0.37
Q96RS6	NudC domain-containing protein 1 (Chronic myelogenous leukemia tumor antigen 66) (Tumor antigen CML66)	EBI-20723339	0.35
Q9HCE5	N6-adenosine-methyltransferase non-catalytic subunit (Methyltransferase-like protein 14) (hMETTL14)	EBI-20595531	0.35
Q9NZV6	Methionine-R-sulfoxide reductase B1 (MsrB1) (EC 1.8.4.12) (EC 1.8.4.14) (Selenoprotein X) (SelX)	EBI-20976398	0.67
Q5S007	Leucine-rich repeat serine/threonine-protein kinase 2 (EC 2.7.11.1) (EC 3.6.5.-) (Dardarin)	EBI-21360986	0.35
Q9NRD1	F-box only protein 6 (F-box protein that recognizes sugar chains 2) (F-box/G-domain protein 2)	EBI-21259874	0.35
Q14108	Lysosome membrane protein 2 (85 kDa lysosomal membrane sialoglycoprotein) (LGP85) (CD36 antigen-like 2) (Lysosome membrane protein II) (LIMP II) (Scavenger receptor class B member 2) (CD antigen CD36)	EBI-21264396	0.35
Q9Y275	Tumor necrosis factor ligand superfamily member 13B (B lymphocyte stimulator) (BLyS) (B-cell-activating factor) (BAFF) (Dendritic cell-derived TNF-like molecule) (TNF- and APOL-related leukocyte expressed ligand 1) (TALL-1) (CD antigen CD257) [Cleaved into: Tumor necrosis factor ligand superfamily member 13b, membrane form; Tumor necrosis factor ligand superfamily member 13b, soluble form]	EBI-21266480	0.35
Q16799	Reticulon-1 (Neuroendocrine-specific protein)	EBI-21368794	0.37
Q15185	Prostaglandin E synthase 3 (EC 5.3.99.3) (Cytosolic prostaglandin E2 synthase) (cPGES) (Hsp90 co-chaperone) (Progesterone receptor complex p23) (Telomerase-binding protein p23)	EBI-21370704	0.00
Q9UBU8	Mortality factor 4-like protein 1 (MORF-related gene 15 protein) (Protein MSL3-1) (Transcription factor-like protein MRG15)	EBI-21370901	0.00
Q96PY5	Formin-like protein 2 (Formin homology 2 domain-containing protein 2)	EBI-21371604	0.00
P11766	Alcohol dehydrogenase class-3 (EC 1.1.1.1) (Alcohol dehydrogenase 5) (Alcohol dehydrogenase class chi chain) (Alcohol dehydrogenase class-III) (Glutathione-dependent formaldehyde dehydrogenase) (FALDH) (FDH) (GSH-FDH) (EC 1.1.1.-) (S-(hydroxymethyl)glutathione dehydrogenase) (EC 1.1.1.284)	EBI-21372154	0.00
Q7Z699	Sprouty-related, EVH1 domain-containing protein 1 (Spred-1) (hSpred1)	EBI-21372907	0.00
P14868	Aspartate--tRNA ligase, cytoplasmic (EC 6.1.1.12) (Aspartyl-tRNA synthetase) (AspRS) (Cell proliferation-inducing gene 40 protein)	EBI-21372879	0.00
P36957	Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial (EC 2.3.1.61) (2-oxoglutarate dehydrogenase complex component E2) (OGDC-E2) (Dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex) (E2K)	EBI-21373212	0.00
Q7Z698	Sprouty-related, EVH1 domain-containing protein 2 (Spred-2)	EBI-21373545	0.00
Q9UL68	Myelin transcription factor 1-like protein (MyT1-L) (MyT1L)	EBI-21374623	0.00
O75592	E3 ubiquitin-protein ligase MYCBP2 (EC 2.3.2.33) (Myc-binding protein 2) (Protein associated with Myc)	EBI-21374795	0.00
Q86TG7	Retrotransposon-derived protein PEG10 (Embryonal carcinoma differentiation-regulated protein) (Mammalian retrotransposon-derived protein 2) (Myelin expression factor 3-like protein 1) (MEF3-like protein 1) (Paternally expressed gene 10 protein) (Retrotransposon gag domain-containing protein 3) (Retrotransposon-derived gag-like polyprotein) (Ty3/Gypsy-like protein)	EBI-21374847	0.00
P02794	Ferritin heavy chain (Ferritin H subunit) (EC 1.16.3.1) (Cell proliferation-inducing gene 15 protein) [Cleaved into: Ferritin heavy chain, N-terminally processed]	EBI-21376448	0.00
Q6AI39	BRD4-interacting chromatin-remodeling complex-associated protein-like (Glioma tumor suppressor candidate region gene 1 protein-like)	EBI-21376290	0.00
Q6GYQ0	Ral GTPase-activating protein subunit alpha-1 (GAP-related-interacting partner to E12) (GRIPE) (GTPase-activating Rap/Ran-GAP domain-like 1) (Tuberin-like protein 1) (p240)	EBI-21376644	0.00
Q96EK5	KIF-binding protein (KIF1-binding protein) (Kinesin family binding protein)	EBI-21377229	0.00
Q00994	Protein BEX3 (Brain-expressed X-linked protein 3) (Nerve growth factor receptor-associated protein 1) (Ovarian granulosa cell 13.0 kDa protein HGR74) (p75NTR-associated cell death executor)	EBI-21377480	0.00
F8VWT9	Probable E3 ubiquitin-protein ligase HECTD4	EBI-21378210	0.00
Q13439	Golgin subfamily A member 4 (256 kDa golgin) (Golgin-245) (Protein 72.1) (Trans-Golgi p230)	EBI-21378008	0.00
P08238	Heat shock protein HSP 90-beta (HSP 90) (Heat shock 84 kDa) (HSP 84) (HSP84)	EBI-21379316	0.00
P07900	Heat shock protein HSP 90-alpha (EC 3.6.4.10) (Heat shock 86 kDa) (HSP 86) (HSP86) (Lipopolysaccharide-associated protein 2) (LAP-2) (LPS-associated protein 2) (Renal carcinoma antigen NY-REN-38)	EBI-21379300	0.00
Q6ZMI3	Gliomedin [Cleaved into: Gliomedin shedded ectodomain]	EBI-21379522	0.00
Q5SZL2	Centrosomal protein of 85 kDa-like (Serologically defined breast cancer antigen NY-BR-15)	EBI-21380088	0.00
P26367	Paired box protein Pax-6 (Aniridia type II protein) (Oculorhombin)	EBI-21381283	0.00
Q9NR80	Rho guanine nucleotide exchange factor 4 (APC-stimulated guanine nucleotide exchange factor 1) (Asef) (Asef1)	EBI-21381216	0.00
Q9UBW8	COP9 signalosome complex subunit 7a (SGN7a) (Signalosome subunit 7a) (Dermal papilla-derived protein 10) (JAB1-containing signalosome subunit 7a)	EBI-21381443	0.00
Q9Y575	Ankyrin repeat and SOCS box protein 3 (ASB-3)	EBI-21381570	0.00
P48426	Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha (EC 2.7.1.149) (1-phosphatidylinositol 5-phosphate 4-kinase 2-alpha) (Diphosphoinositide kinase 2-alpha) (PIP5KIII) (Phosphatidylinositol 5-Phosphate 4-Kinase) (PI5P4Kalpha) (Phosphatidylinositol 5-phosphate 4-kinase type II alpha) (PI(5)P 4-kinase type II alpha) (PIP4KII-alpha) (PtdIns(4)P-5-kinase B isoform) (PtdIns(4)P-5-kinase C isoform) (PtdIns(5)P-4-kinase isoform 2-alpha)	EBI-21382180	0.00
Q9BZ95	Histone-lysine N-methyltransferase NSD3 (EC 2.1.1.370) (EC 2.1.1.371) (Nuclear SET domain-containing protein 3) (Protein whistle) (WHSC1-like 1 isoform 9 with methyltransferase activity to lysine) (Wolf-Hirschhorn syndrome candidate 1-like protein 1) (WHSC1-like protein 1)	EBI-21382818	0.00
Q9NVR2	Integrator complex subunit 10 (Int10)	EBI-21383211	0.00
Q9NWB6	Arginine and glutamate-rich protein 1	EBI-21383120	0.00
Q5VTB9	E3 ubiquitin-protein ligase RNF220 (EC 2.3.2.27) (RING finger protein 220) (RING-type E3 ubiquitin transferase RNF220)	EBI-21383239	0.00
P53041	Serine/threonine-protein phosphatase 5 (PP5) (EC 3.1.3.16) (Protein phosphatase T) (PP-T) (PPT)	EBI-21383361	0.00
P31321	cAMP-dependent protein kinase type I-beta regulatory subunit	EBI-21383806	0.00
Q9NPF5	DNA methyltransferase 1-associated protein 1 (DNMAP1) (DNMT1-associated protein 1)	EBI-21384190	0.00
Q58WW2	DDB1- and CUL4-associated factor 6 (Androgen receptor complex-associated protein) (ARCAP) (IQ motif and WD repeat-containing protein 1) (Nuclear receptor interaction protein) (NRIP)	EBI-21383966	0.00
Q6NUQ1	RAD50-interacting protein 1 (RAD50 interactor 1) (HsRINT-1) (RINT-1)	EBI-21385792	0.00
Q9BXM7	Serine/threonine-protein kinase PINK1, mitochondrial (EC 2.7.11.1) (BRPK) (PTEN-induced putative kinase protein 1)	EBI-21386538	0.00
Q07890	Son of sevenless homolog 2 (SOS-2)	EBI-21387074	0.00
Q99615	DnaJ homolog subfamily C member 7 (Tetratricopeptide repeat protein 2) (TPR repeat protein 2)	EBI-21387981	0.00
P26640	Valine--tRNA ligase (EC 6.1.1.9) (Protein G7a) (Valyl-tRNA synthetase) (ValRS)	EBI-21388258	0.00
Q15059	Bromodomain-containing protein 3 (RING3-like protein)	EBI-21389314	0.00
Q9C093	Sperm flagellar protein 2 (Protein KPL2)	EBI-21389142	0.00
Q9H974	Queuine tRNA-ribosyltransferase accessory subunit 2 (Queuine tRNA-ribosyltransferase domain-containing protein 1)	EBI-21389084	0.00
Q96MT8	Centrosomal protein of 63 kDa (Cep63)	EBI-21389423	0.00
Q14515	SPARC-like protein 1 (High endothelial venule protein) (Hevin) (MAST 9)	EBI-21390086	0.00
Q96K75	Zinc finger protein 514	EBI-21390447	0.00
Q92610	Zinc finger protein 592	EBI-21392680	0.00
Q9Y2B5	VPS9 domain-containing protein 1 (Protein ATP-BL)	EBI-21392543	0.00
P27918	Properdin (Complement factor P)	EBI-21995211	0.35
P37840	Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP)	EBI-25295611	0.66
P0DOF2	Matrix protein (Phosphoprotein M2)	EBI-25603126	0.35
O96028	Histone-lysine N-methyltransferase NSD2 (EC 2.1.1.357) (Multiple myeloma SET domain-containing protein) (MMSET) (Nuclear SET domain-containing protein 2) (Protein trithorax-5) (Wolf-Hirschhorn syndrome candidate 1 protein)	EBI-25486814	0.35
Q9BY14	Testis-expressed protein 101 (Cell surface receptor NYD-SP8) (Scleroderma-associated autoantigen) (Spermatogenesis-related gene protein)	EBI-25505396	0.35
P0DTC3	ORF3a protein (ORF3a) (Accessory protein 3a) (Protein 3a) (Protein U274) (Protein X1)	EBI-25686340	0.35
P0DTC8	ORF8 protein (ORF8) (Non-structural protein 8) (ns8)	EBI-25687968	0.35
Q5EP34	Polymerase acidic protein (EC 3.1.-.-) (RNA-directed RNA polymerase subunit P2)	EBI-25773054	0.35
Q15672	Twist-related protein 1 (Class A basic helix-loop-helix protein 38) (bHLHa38) (H-twist)	EBI-25824698	0.37
P78352	Disks large homolog 4 (Postsynaptic density protein 95) (PSD-95) (Synapse-associated protein 90) (SAP-90) (SAP90)	EBI-26509146	0.37
Q9BYB0	SH3 and multiple ankyrin repeat domains protein 3 (Shank3) (Proline-rich synapse-associated protein 2) (ProSAP2)	EBI-26513929	0.37
Q8N488	RING1 and YY1-binding protein (Apoptin-associating protein 1) (APAP-1) (Death effector domain-associated factor) (DED-associated factor) (YY1 and E4TF1-associated factor 1)	EBI-27111302	0.35
P20794	Serine/threonine-protein kinase MAK (EC 2.7.11.1) (Male germ cell-associated kinase)	EBI-28934658	0.35
Q8NI60	Atypical kinase COQ8A, mitochondrial (EC 2.7.-.-) (Chaperone activity of bc1 complex-like) (Chaperone-ABC1-like) (Coenzyme Q protein 8A) (aarF domain-containing protein kinase 3)	EBI-28943519	0.35
Q9H5K3	Protein O-mannose kinase (POMK) (EC 2.7.1.183) (Protein kinase-like protein SgK196) (Sugen kinase 196)	EBI-28948637	0.35
Q16832	Discoidin domain-containing receptor 2 (Discoidin domain receptor 2) (EC 2.7.10.1) (CD167 antigen-like family member B) (Discoidin domain-containing receptor tyrosine kinase 2) (Neurotrophic tyrosine kinase, receptor-related 3) (Receptor protein-tyrosine kinase TKT) (Tyrosine-protein kinase TYRO10) (CD antigen CD167b)	EBI-32717626	0.42
P11362	Fibroblast growth factor receptor 1 (FGFR-1) (EC 2.7.10.1) (Basic fibroblast growth factor receptor 1) (BFGFR) (bFGF-R-1) (Fms-like tyrosine kinase 2) (FLT-2) (N-sam) (Proto-oncogene c-Fgr) (CD antigen CD331)	EBI-32718427	0.35
Q16288	NT-3 growth factor receptor (EC 2.7.10.1) (GP145-TrkC) (Trk-C) (Neurotrophic tyrosine kinase receptor type 3) (TrkC tyrosine kinase)	EBI-32719212	0.35
P09619	Platelet-derived growth factor receptor beta (PDGF-R-beta) (PDGFR-beta) (EC 2.7.10.1) (Beta platelet-derived growth factor receptor) (Beta-type platelet-derived growth factor receptor) (CD140 antigen-like family member B) (Platelet-derived growth factor receptor 1) (PDGFR-1) (CD antigen CD140b)	EBI-32719373	0.35
P07949	Proto-oncogene tyrosine-protein kinase receptor Ret (EC 2.7.10.1) (Cadherin family member 12) (Proto-oncogene c-Ret) [Cleaved into: Soluble RET kinase fragment; Extracellular cell-membrane anchored RET cadherin 120 kDa fragment]	EBI-32719411	0.35
P34925	Tyrosine-protein kinase RYK (EC 2.7.10.1)	EBI-32719634	0.35
Q06418	Tyrosine-protein kinase receptor TYRO3 (EC 2.7.10.1) (Tyrosine-protein kinase BYK) (Tyrosine-protein kinase DTK) (Tyrosine-protein kinase RSE) (Tyrosine-protein kinase SKY) (Tyrosine-protein kinase TIF)	EBI-32719716	0.35

Cross-References

Database	Links
UNIPROT	P10909 B2R9Q1 B3KSE6 P11380 P11381 Q2TU75 Q5HYC1 Q7Z5B9
Pfam	PF01093
PROSITE	PS00492 PS00493
OMIM	185430
DisGeNET	1191

Clusterin alpha chain (Homo sapiens)

General Information

Protein Information

Subcellular Location

Description Show

Position in the Nuclear Envelope

Membrane Topology

Assigned Ontology terms

Biology & Function

Description Hide

Assigned Ontology terms

Protein-Protein Interactions

Interactions with Nuclear Envelope proteins (12 interactors)

Interactions with other proteins (155 interactors)

Cross-References

Database

Links

Description

Description